DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: QC and LOC108644434

Sequence 1:NP_729109.1 Gene:QC FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_017949751.1 Gene:LOC108644434 ID: Length:295 Species:Xenopus tropicalis

Alignment Length:294 Identity:127/295 (43%)
Similarity:179/295 (61%) Gaps:10/295 (3%)


  Fly    41 FNRTLDSILVPRVVGSRGHQQVREYLVQSLNGL--GFQTEVDEFKQRVPVFGELTFANVVGTINP 103
            |...|..:|..|..||.|:..||:::.|.|..|  |:.||.|.|:...| :|.:||:|::.|:||
 Frog     2 FQTDLKPMLTERYAGSPGNYAVRQHIKQRLQSLQAGWVTEEDTFEAPTP-YGYVTFSNIISTLNP 65

  Fly   104 QAQNFLALACHYDSKYF-PNDPG--FVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLI 165
            .|:..|.|||||||||| |...|  ||||.|:|||||::|..|:.|.:.|:|:..::.|:.|.||
 Frog    66 SAKRHLVLACHYDSKYFSPQWDGRVFVGAIDAAVPCAMMLELARALDSSLKKKLNSKLDLSLQLI 130

  Fly   166 FFDGEEAFKEWTDADSVYGSKHLAAKLASKRSGSQAQLAPRNIDRIEVLVLLDLIGARNPKFSSF 230
            ||||||||:.|:..||:|||||||.|:.:......|: ....:..|::.:||||||..||.|.::
 Frog   131 FFDGEEAFQRWSSYDSLYGSKHLAQKMETISHPPNAE-NTNQLHGIDLFILLDLIGTANPVFPNY 194

  Fly   231 YENTDGLHSSLVQIEKSLRTAGQLEGNNN---MFLSRVSGGLVDDDHRPFLDENVPVLHLVATPF 292
            ::||....:.|..||:.|.....|:.:.:   .|.|......|.|||.|||...||:|||:.:||
 Frog   195 FQNTARWFNRLQSIERRLHGLNLLKNHPSEVQYFQSGFRARPVLDDHVPFLQIGVPILHLIPSPF 259

  Fly   293 PDVWHTPRDNAANLHWPSIRNFNRVFRNFVYQYL 326
            |:||||..||..||...:|.|.|::.:.||.:||
 Frog   260 PEVWHTMEDNEENLDSATIENLNKILQVFVLEYL 293

Known Domains:


GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 125/292 (43%)
LOC108644434XP_017949751.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1257754at2759
OrthoFinder 1 1.000 FOG0000952
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.