DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: QC and qpctl

Sequence 1:NP_729109.1 Gene:QC FlyBaseID:FBgn0052412 Length:340 Species:Drosophila melanogaster
Sequence 2:XP_002932645.1 Gene:qpctl XenbaseID:XB-GENE-940804 Length:382 Species:Xenopus tropicalis

Alignment Length:351 Identity:125/352 (36%)
Similarity:181/352 (51%) Gaps:37/352 (11%)


  Fly     3 IGSVVFAAAGLLLL----------------------LLPPSHQQATAGNIGSQWRDDEVHFNRTL 45
            :|:.|...||:||.                      ::|.:...:....|.|:...|.: ::..|
 Frog    32 LGAGVLIGAGILLWENWEVSGKVRENGRKETRSGREIVPKAMSISHIRQIVSKVNSDRL-WSSFL 95

  Fly    46 DSILVPRVVGSRGHQQVREYLVQSLNGL--GFQTEVDEFKQRVPVFGELTFANVVGTINPQAQNF 108
            ..:|:.|..||.|:..|||.:...|..|  |:..::|.|....| .|.|:|.:||.|::|.|...
 Frog    96 KPMLIERPPGSEGNVMVRELISTHLQTLSSGWTVDLDLFDAVTP-RGSLSFGSVVATLDPYAPQR 159

  Fly   109 LALACHYDSKYF-PNDPG--FVGATDSAVPCAILLNTAKTLGAYLQKEFRNRSDVGLMLIFFDGE 170
            |.||||.|||:| |:..|  |:|||||||||:::|.....|.:.|:|.....|.:.|.|.|.|||
 Frog   160 LVLACHLDSKWFLPDRRGRPFIGATDSAVPCSLILEAVTALDSELRKLKDRGSTLTLQLFFLDGE 224

  Fly   171 EAFKEWTDADSVYGSKHLAAKL-ASKRSGSQAQLAPRNIDRIEVLVLLDLIGARNPKFSSFYENT 234
            ||..|||..||:||::|||.:| .||..|...    .::..|.:.|||||:||.:....:.:..|
 Frog   225 EALAEWTATDSLYGARHLAQRLEKSKLPGGDG----NHLSAIALFVLLDLLGAPDLLILNHFSET 285

  Fly   235 DGLHSSLVQIEKSLRTAGQLEGN---NNMFLSRVSGGLVDDDHRPFLDENVPVLHLVATPFPDVW 296
            ......|..|||.|...|.|:.:   :..|...:..|.|:|||.|||.:.||:||:::||||.||
 Frog   286 RSHFLRLCTIEKRLHNLGLLQSHPSEHTYFRPDLYYGPVEDDHIPFLRKGVPILHVISTPFPAVW 350

  Fly   297 HTPRDNAANLHWPSIRNFNRVFRNFV 322
            ||..|...|||.|::.|...:...|:
 Frog   351 HTHDDTEENLHRPTVINLCHILVTFL 376

Known Domains:


GeneSequenceDomainRegion External IDIdentity
QCNP_729109.1 M28_QC_like 36..325 CDD:193501 116/297 (39%)
qpctlXP_002932645.1 M28_QC_like 82..378 CDD:193501 117/302 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C262777224
eggNOG 1 0.900 E1_KOG3946
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1257754at2759
OrthoFinder 1 1.000 FOG0000952
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.681 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.