DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG18586 and AAE14

DIOPT Version :9

Sequence 1:NP_647993.2 Gene:CG18586 / 38659 FlyBaseID:FBgn0035642 Length:545 Species:Drosophila melanogaster
Sequence 2:NP_001322322.1 Gene:AAE14 / 839932 AraportID:AT1G30520 Length:560 Species:Arabidopsis thaliana


Alignment Length:406 Identity:91/406 - (22%)
Similarity:161/406 - (39%) Gaps:83/406 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   196 DHTLAILSSSGTSGFPKAVTISNSHKIIVDYMAI-----NNSNIQYTSSTLDWCSGLSMAITSGV 255
            |..:.|..:|||:|.||.||||:...|......|     ...::...:|.|....|||.|:...:
plant   172 DDAVVICFTSGTTGRPKGVTISHLAFITQSLAKIAIAGYGEDDVYLHTSPLVHIGGLSSAMAMLM 236

  Fly   256 FSTTSIIADCDFDPGLFCRAIGKYRISMVLLSSSYLAIFANCPEFESADLSSLN----------- 309
            .....::.. .||.          :.::.::..:::..|...|.. .|||..:|           
plant   237 VGACHVLLP-KFDA----------KTALQVMEQNHITCFITVPAM-MADLIRVNRTTKNGAENRG 289

  Fly   310 --YVIFGGSSCSLEVQRKVRSRLSHDCLNFCYGLTELNSAGSVN----------------LNFDE 356
              .::.||.|.|.|:.::..:......:...||:||..|:.:..                ||..:
plant   290 VRKILNGGGSLSSELLKEAVNIFPCARILSAYGMTEACSSLTFMTLHDPTQESFKVTYPLLNQPK 354

  Fly   357 KPNSVGRAIRGIKIKV-IDEQGEAQEPNVVGEICF---HNSQKWAGYYKNPD--ETRQIQDSENW 415
            :...||:....|::.| :||     :.:.||:|..   |...::.|:....:  ||.:.:.:|.|
plant   355 QGTCVGKPAPHIELMVKLDE-----DSSRVGKILTRGPHTMLRYWGHQVAQENVETSESRSNEAW 414

  Fly   416 IHTGDLGYVDKDGYLFVIDRLKDMLKYQNIMYYPSEIENVIAEMPNVLEACVFGIWDPVNGDEAA 480
            :.|||:|..|:.|.|::|.|....:|......||.|:|.|:.|.|.::.|.|.|:.|...|:...
plant   415 LDTGDIGAFDEFGNLWLIGRSNGRIKTGGENVYPEEVEAVLVEHPGIVSAVVIGVIDTRLGEMVV 479

  Fly   481 ASL------------VKKPGTQLEAQDVVEYVRKRITAKFKQLNGGALIVDQIVR-------SGN 526
            |.:            .:|...||.::.:..:.|.:....||       |..:.||       :..
plant   480 ACVRLQEKWIWSDVENRKGSFQLSSETLKHHCRTQNLTGFK-------IPKRFVRWEKQFPLTTT 537

  Fly   527 RKTNRSAVKEHFLKNY 542
            .|..|..|:...|.::
plant   538 GKVKRDEVRRQVLSHF 553

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG18586NP_647993.2 CaiC 35..541 CDD:223395 91/403 (23%)
AFD_class_I 55..530 CDD:302604 88/392 (22%)
AAE14NP_001322322.1 PLN02860 1..560 CDD:215464 91/406 (22%)
AFD_class_I 42..>269 CDD:302604 23/107 (21%)
AFD_class_I 172..546 CDD:302604 89/397 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0318
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.