DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment vn and fat1b

DIOPT Version :9

Sequence 1:	NP_523942.2	Gene:	vn / 38657	FlyBaseID:	FBgn0003984	Length:	623	Species:	Drosophila melanogaster
Sequence 2:	XP_021328497.1	Gene:	fat1b / 565591	ZFINID:	ZDB-GENE-130530-563	Length:	4503	Species:	Danio rerio

Alignment Length:	65	Identity:	18/65 - (27%)
Similarity:	29/65 - (44%)	Gaps:	15/65 - (23%)

- Green bases have known domain annotations that are detailed below.

  Fly   536 KASKAIAKRRIMIKASPVHFPTDRSASGIPCNFDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCE 600
            |.|.:.:..|..:|.|             ||:.:.|.:.|||  |.:..:..|:|..:|.|.||:
Zfish  4055 KCSPSFSGTRCEVKIS-------------PCDSNPCLYGGTC--IQNNLDYSCKCRGKYSGQRCQ 4104

Fly 601 600
Zfish 4105 4104

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
vn	NP_523942.2	IGc2	471..538	CDD:197706	1/1 (100%)
vn	NP_523942.2	EGF	566..598	CDD:278437	10/31 (32%)
fat1b	XP_021328497.1	Cadherin_repeat	45..150	CDD:206637
		Cadherin_repeat	159..259	CDD:206637
		E_set	272..359	CDD:324323
		Cadherin_repeat	377..467	CDD:206637
		Cadherin_repeat	476..573	CDD:206637
		Cadherin_repeat	584..673	CDD:206637
		Cadherin_repeat	729..826	CDD:206637
		Cadherin_repeat	834..931	CDD:206637
		Cadherin_repeat	939..1036	CDD:206637
		Cadherin_repeat	1050..1143	CDD:206637
		Cadherin_repeat	1151..1249	CDD:206637
		Cadherin_repeat	1273..1347	CDD:206637
		Cadherin_repeat	1365..1477	CDD:206637
		Cadherin_repeat	1485..1583	CDD:206637
		Cadherin_repeat	1591..1687	CDD:206637
		Cadherin_repeat	1696..1786	CDD:206637
		Cadherin_repeat	1794..1899	CDD:206637
		Cadherin_repeat	1908..1996	CDD:206637
		Cadherin_repeat	2008..2102	CDD:206637
		Cadherin_repeat	2110..2199	CDD:206637
		Cadherin_repeat	2211..2303	CDD:206637
		Cadherin_repeat	2311..2410	CDD:206637
		Cadherin_repeat	2419..2512	CDD:206637
		Cadherin_repeat	2520..2616	CDD:206637
		Cadherin_repeat	2624..2714	CDD:206637
		Cadherin_repeat	2730..2825	CDD:206637
		Cadherin_repeat	2838..>2915	CDD:206637
		Cadherin_repeat	2943..3041	CDD:206637
		Cadherin_repeat	3054..3143	CDD:206637
		Cadherin_repeat	3153..3248	CDD:206637
		Cadherin_repeat	3256..3353	CDD:206637
		Cadherin_repeat	3361..3458	CDD:206637
		Cadherin_repeat	3467..3553	CDD:206637
		Cadherin_repeat	3567..3652	CDD:206637
		Laminin_G_2	3881..4001	CDD:308045
		EGF	4033..4064	CDD:306513	2/8 (25%)
		EGF_CA	4069..4104	CDD:238011	13/49 (27%)
		EGF	4109..4139	CDD:306513
		EGF_CA	4143..4179	CDD:238011
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910