DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment vn and lrp1bb

DIOPT Version :9

Sequence 1:	NP_523942.2	Gene:	vn / 38657	FlyBaseID:	FBgn0003984	Length:	623	Species:	Drosophila melanogaster
Sequence 2:	XP_021334671.1	Gene:	lrp1bb / 559293	ZFINID:	ZDB-GENE-070912-401	Length:	4600	Species:	Danio rerio

Alignment Length:	196	Identity:	40/196 - (20%)
Similarity:	63/196 - (32%)	Gaps:	59/196 - (30%)

- Green bases have known domain annotations that are detailed below.

  Fly   428 LGQP--MRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAIIKHGKK--LRIVCEVSGQPPPKV 488
            ||:|  ..||.......|..:.:|:..|.....:.|         |.:  .|.:.|.:|.
Zfish  4237 LGKPTCRCVTGFTGPNCERRICDNHCLNGGTCDVSS---------GNQPVCRCLAEYTGD----- 4287

  Fly   489 TWFKDEKSINRKRNIYQFKHHKRRSELIVRSFNSS----SDAGRYE--CRAKNKASKAIAKRRIM 547
                        |.:|...||        ...||.    |.:|..|  |.|:.:..|....:.:.
Zfish  4288 ------------RCLYHICHH--------HCVNSKACTLSSSGHVECVCPARYEGIKCDVDKCLR 4332

  Fly   548 IKASPVHFPTDRSASGIPCNF-------------DYCFHNGTCRMIPDINEVYCRCPTEYFGNRC 599
            ...:|.....|  ...:.||.             .||::.|||.:.||.:..:|.|...:...||
Zfish  4333 CHGAPCIINGD--TGDVACNCTSGRIASSCQLCDGYCYNGGTCHLDPDTSLPFCHCTAGFKNQRC 4395

  Fly   600 E 600
            :
Zfish  4396 D 4396

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
vn	NP_523942.2	IGc2	471..538	CDD:197706	15/74 (20%)
vn	NP_523942.2	EGF	566..598	CDD:278437	11/44 (25%)
lrp1bb	XP_021334671.1	LDLa	38..76	CDD:294076
		FXa_inhibition	128..156	CDD:317114
		LY	238..274	CDD:214531
		LY	282..324	CDD:214531
		LY	326..367	CDD:214531
		FXa_inhibition	452..484	CDD:317114
		LY	516..558	CDD:214531
		LY	559..598	CDD:214531
		LY	605..654	CDD:214531
		LY	655..697	CDD:214531
		FXa_inhibition	766..801	CDD:317114
		LDLa	854..887	CDD:238060
		LDLa	895..926	CDD:197566
		LDLa	939..970	CDD:238060
		LDLa	974..1005	CDD:197566
		LDLa	1021..1056	CDD:238060
		LDLa	1065..1099	CDD:238060
		FXa_inhibition	1144..1180	CDD:317114
		FXa_inhibition	1192..1220	CDD:317114
		LY	1248..1289	CDD:214531
		LY	1295..1337	CDD:214531
		LY	1339..1382	CDD:214531
		LY	<1394..1427	CDD:214531
		Ldl_recept_b	1586..1625	CDD:278487
		LY	1609..1651	CDD:214531
		LY	1653..1693	CDD:214531
		LY	<1703..1734	CDD:214531
		FXa_inhibition	1806..1842	CDD:317114
		NHL	<1858..1941	CDD:302697
		NHL repeat	1879..1916	CDD:271320
		LY	1915..1955	CDD:214531
		Ldl_recept_b	1976..2016	CDD:278487
		LY	2001..2041	CDD:214531
		FXa_inhibition	2115..2150	CDD:317114
		Ldl_recept_b	2298..2339	CDD:278487
		LY	2323..2365	CDD:214531
		FXa_inhibition	2436..2470	CDD:317114
		LDLa	2482..2511	CDD:238060
		LDLa	2520..2554	CDD:238060
		LDLa	2559..2593	CDD:238060
		LDLa	<2613..2642	CDD:294076
		LDLa	2650..2684	CDD:238060
		LDLa	2688..2719	CDD:238060
		LDLa	2728..2761	CDD:197566
		LDLa	2772..2804	CDD:197566
		LDLa	2813..2846	CDD:238060
		LDLa	2859..2893	CDD:238060
		cEGF	2916..2939	CDD:315355
		EGF_CA	2936..2969	CDD:214542
		LY	3003..3047	CDD:214531
		LY	3050..3086	CDD:214531
		LY	3135..3174	CDD:214531
		FXa_inhibition	3245..3281	CDD:317114
		LDLa	3285..3316	CDD:197566
		LDLa	3325..3359	CDD:238060
		LDLa	3364..3399	CDD:238060
		LDLa	3404..3439	CDD:238060
		LDLa	3444..3478	CDD:238060
		LDLa	3483..3517	CDD:238060
		LDLa	3521..3555	CDD:238060
		LDLa	3563..3597	CDD:238060
		LDLa	3601..3636	CDD:238060
		LDLa	3643..3675	CDD:238060
		LDLa	3730..3765	CDD:238060
Ldl_recept_b	4008..4048	CDD:278487
LY	4032..4073	CDD:214531
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	0.910