DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and ft

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_477497.1 Gene:ft / 33627 FlyBaseID:FBgn0001075 Length:5147 Species:Drosophila melanogaster


Alignment Length:271 Identity:63/271 - (23%)
Similarity:95/271 - (35%) Gaps:87/271 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SATTQQQQQ----QQQQQQH------LPRLWEG-------SAEESSYYIPLSSDNGSGSSESSA- 85
            ||.|..:.|    |||||||      :.|...|       ||..:....||:  ..|.|||.|: 
  Fly  4786 SAYTHHKHQNSGSQQQQQQHRHTAPFVTRNQGGQPPPPPTSASRTHQSTPLA--RLSPSSELSSQ 4848

  Fly    86 ---------------ESGSSSSRSSSNNIDNNILSRL-LSLNSNSLSSRSNVKLKPATVFDAGSS 134
                           :|...::.|||..:..::.|.. .||||..:|..|            |.|
  Fly  4849 QPRILTLHDISGKPLQSALLATTSSSGGVGKDVHSNSERSLNSPVMSQLS------------GQS 4901

  Fly   135 TPAQQEQHVAAVPEQQQQQQQQQQSMQKVPNTLINSQIYNLLYNGMPS--------EAASSKMRR 191
            :.|.:::  ..||:||.||.....:.:::..           .||.|.        :|.||....
  Fly  4902 SSASRQK--PGVPQQQAQQTSMGLTAEEIER-----------LNGRPRTCSLISTLDAVSSSSEA 4953

  Fly   192 HIQPSQLPHQP-----ESRAQLPSNYSSRPAVRSYLIE----------SYEMPESMLEDRSPEQA 241
            ....|...|..     ::.:...::.|...:.....||          .|...:|:|:.|||...
  Fly  4954 PRVSSSALHMSLGGDVDAHSSTSTDESGNDSFTCSEIEYDNNSLSGDGKYSTSKSLLDGRSPVSR 5018

  Fly   242 ARSRRDGSNTN 252
            |.|   |..|:
  Fly  5019 ALS---GGETS 5026

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706
EGF 566..598 CDD:278437
ftNP_477497.1 Cadherin_repeat 71..152 CDD:206637
Cadherin_repeat 163..266 CDD:206637
Cadherin_repeat 275..378 CDD:206637
Cadherin_repeat 393..490 CDD:206637
Cadherin_repeat 498..594 CDD:206637
Cadherin_repeat 603..704 CDD:206637
Cadherin_repeat 735..814 CDD:206637
Cadherin 843..>907 CDD:278457
Cadherin 950..1026 CDD:278457
Cadherin_repeat 1053..1149 CDD:206637
Cadherin_repeat 1157..1274 CDD:206637
Cadherin_repeat 1282..1380 CDD:206637
Cadherin_repeat 1390..1485 CDD:206637
Cadherin_repeat 1497..1597 CDD:206637
Cadherin_repeat 1621..1699 CDD:206637
Cadherin_repeat 1720..1818 CDD:206637
Cadherin_repeat 1827..1918 CDD:206637
Cadherin_repeat 1926..2023 CDD:206637
Cadherin_repeat 2031..2162 CDD:206637
Cadherin_repeat 2172..2274 CDD:206637
Cadherin_repeat 2282..2380 CDD:206637
Cadherin_repeat 2388..2487 CDD:206637
Cadherin_repeat 2495..2592 CDD:206637
Cadherin_repeat 2600..2694 CDD:206637
Cadherin_repeat 2710..2806 CDD:206637
Cadherin_repeat 2814..2909 CDD:206637
Cadherin_repeat 2917..3009 CDD:206637
Cadherin 3018..3114 CDD:278457
Cadherin 3129..3220 CDD:278457
Cadherin_repeat 3233..3330 CDD:206637
Cadherin_repeat 3338..3434 CDD:206637
Cadherin_repeat 3443..3541 CDD:206637
Cadherin_repeat 3550..3647 CDD:206637
Cadherin_repeat 3657..3753 CDD:206637
EGF 4017..4047 CDD:278437
EGF_CA 4056..4090 CDD:238011
EGF_CA 4094..4128 CDD:238011
Laminin_G_1 4156..4306 CDD:278483
LamG 4428..4543 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.