powered by:
Protein Alignment vn and ptgs2a
DIOPT Version :9
Sequence 1: | NP_523942.2 |
Gene: | vn / 38657 |
FlyBaseID: | FBgn0003984 |
Length: | 623 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_705943.1 |
Gene: | ptgs2a / 246227 |
ZFINID: | ZDB-GENE-020530-2 |
Length: | 601 |
Species: | Danio rerio |
Alignment Length: | 36 |
Identity: | 11/36 - (30%) |
Similarity: | 15/36 - (41%) |
Gaps: | 2/36 - (5%) |
- Green bases have known domain annotations that are detailed below.
Fly 565 PCNFDYCFHNGTCRMIPDINEVYCRCP-TEYFGNRC 599
||....|.:.|.| :....:...|.|. |.|:|..|
Zfish 23 PCCAQPCQNQGVC-LSKGADAYECDCTRTGYYGENC 57
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.