Sequence 1: | NP_523942.2 | Gene: | vn / 38657 | FlyBaseID: | FBgn0003984 | Length: | 623 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006509122.1 | Gene: | Nrg1 / 211323 | MGIID: | 96083 | Length: | 884 | Species: | Mus musculus |
Alignment Length: | 242 | Identity: | 56/242 - (23%) |
---|---|---|---|
Similarity: | 92/242 - (38%) | Gaps: | 55/242 - (22%) |
- Green bases have known domain annotations that are detailed below.
Fly 410 DISYMMFVQ-QTN-----PGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAII 468
Fly 469 KHGKKLRIVCEVSGQ-PPPKVTWFKDEKSINRKRNIYQFKHHKR--RSELIVRSFNSSSDAGRYE 530
Fly 531 CRAKNKASKAIAKRRIMI--------------------KASPVHF-----------PTDRSASG- 563
Fly 564 ---IPC---NFDYCFHNGTCRMIPDI---NEVYCRCPTEYFGNRCEN 601 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
vn | NP_523942.2 | IGc2 | 471..538 | CDD:197706 | 22/69 (32%) |
EGF | 566..598 | CDD:278437 | 11/37 (30%) | ||
Nrg1 | XP_006509122.1 | Ig_Pro_neuregulin-1 | 266..340 | CDD:143303 | 21/74 (28%) |
EGF | 403..433 | CDD:333761 | 10/29 (34%) | ||
Neuregulin | 511..866 | CDD:366946 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_28J9V | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X2572 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
3 | 2.810 |