DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and Nrg1

DIOPT Version :10

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_006509122.1 Gene:Nrg1 / 211323 MGIID:96083 Length:884 Species:Mus musculus


Alignment Length:242 Identity:56/242 - (23%)
Similarity:92/242 - (38%) Gaps:55/242 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   410 DISYMMFVQ-QTN-----PGNFTILGQPMRVTHLVVEAVETAVSENYTQNAEVTKIFSKPSKAII 468
            |..|:.|:: ..|     |..|.....|:.....:.:.|...:.:.......:.::.|:.|.|  
Mouse   200 DSRYIFFMEPDANSSGRAPPAFRASFPPLETGRNLKKEVSRVLCKRCALPPRLKEMKSQESAA-- 262

  Fly   469 KHGKKLRIVCEVSGQ-PPPKVTWFKDEKSINRKRNIYQFKHHKR--RSELIVRSFNSSSDAGRYE 530
              |.||.:.||.|.: ...:..|||:...:||:......|..|:  :|||.:.. .|.:|:|.|.
Mouse   263 --GSKLVLRCETSSEYSSLRFKWFKNGNELNRRNKPQNVKIQKKPGKSELRINK-ASLADSGEYM 324

  Fly   531 CRAKNKASKAIAKRRIMI--------------------KASPVHF-----------PTDRSASG- 563
            |:..:|.....|...|.|                    ..||:..           .|..|.:| 
Mouse   325 CKVISKLGNDSASANITIVESNDLTTGMSASTERPYVSSESPIRISVSTEGANTSSSTSTSTTGT 389

  Fly   564 ---IPC---NFDYCFHNGTCRMIPDI---NEVYCRCPTEYFGNRCEN 601
               |.|   ...:|.:.|.|.|:.|:   :...|:||.|:.|:||:|
Mouse   390 SHLIKCAEKEKTFCVNGGECFMVKDLSNPSRYLCKCPNEFTGDRCQN 436

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 Ig 462..540 CDD:472250 24/80 (30%)
Ig strand B 474..478 CDD:409353 1/3 (33%)
Ig strand C 487..491 CDD:409353 0/3 (0%)
Ig strand E 513..517 CDD:409353 3/3 (100%)
Ig strand F 528..533 CDD:409353 2/4 (50%)
EGF 566..598 CDD:394967 11/37 (30%)
Nrg1XP_006509122.1 Ig_Pro_neuregulin-1 250..342 CDD:409476 27/96 (28%)
putative Ig strand A 250..256 CDD:409476 0/5 (0%)
Ig strand B 264..272 CDD:409476 3/7 (43%)
Ig strand C 279..284 CDD:409476 0/4 (0%)
putative Ig strand D 298..303 CDD:409476 1/4 (25%)
Ig strand E 308..312 CDD:409476 3/3 (100%)
Ig strand F 322..327 CDD:409476 2/4 (50%)
Ig strand G 334..342 CDD:409476 2/7 (29%)
EGF 403..433 CDD:394967 10/29 (34%)
Neuregulin 511..866 CDD:426627
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.