DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and EREG

DIOPT Version :10

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:NP_001423.1 Gene:EREG / 2069 HGNCID:3443 Length:169 Species:Homo sapiens


Alignment Length:55 Identity:21/55 - (38%)
Similarity:31/55 - (56%) Gaps:9/55 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   566 CNFD---YCFHNGTCRMIPDINEVYCRCPTEYFGNRCENKW-----PDSRYFVAI 612
            |:.|   ||.| |.|..:.|:::.||||...|.|.|||:.:     |.|:.:||:
Human    68 CSSDMNGYCLH-GQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVAL 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 Ig 462..540 CDD:472250
Ig strand B 474..478 CDD:409353
Ig strand C 487..491 CDD:409353
Ig strand E 513..517 CDD:409353
Ig strand F 528..533 CDD:409353
EGF 566..598 CDD:394967 14/34 (41%)
EREGNP_001423.1 PHA03099 <64..148 CDD:165381 21/55 (38%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.