powered by:
Protein Alignment vn and EREG
DIOPT Version :9
Sequence 1: | NP_523942.2 |
Gene: | vn / 38657 |
FlyBaseID: | FBgn0003984 |
Length: | 623 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001423.1 |
Gene: | EREG / 2069 |
HGNCID: | 3443 |
Length: | 169 |
Species: | Homo sapiens |
Alignment Length: | 55 |
Identity: | 21/55 - (38%) |
Similarity: | 31/55 - (56%) |
Gaps: | 9/55 - (16%) |
- Green bases have known domain annotations that are detailed below.
Fly 566 CNFD---YCFHNGTCRMIPDINEVYCRCPTEYFGNRCENKW-----PDSRYFVAI 612
|:.| ||.| |.|..:.|:::.||||...|.|.|||:.: |.|:.:||:
Human 68 CSSDMNGYCLH-GQCIYLVDMSQNYCRCEVGYTGVRCEHFFLTVHQPLSKEYVAL 121
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
vn | NP_523942.2 |
IGc2 |
471..538 |
CDD:197706 |
|
EGF |
566..598 |
CDD:278437 |
14/34 (41%) |
EREG | NP_001423.1 |
PHA02887 |
<64..148 |
CDD:333467 |
21/55 (38%) |
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.