DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and AgaP_AGAP007924

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_317558.4 Gene:AgaP_AGAP007924 / 1278031 VectorBaseID:AGAP007924 Length:5159 Species:Anopheles gambiae


Alignment Length:305 Identity:59/305 - (19%)
Similarity:100/305 - (32%) Gaps:107/305 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   376 QFALSNSSGECDIYRERLMPRG--MLRSGNDLQQASDISYMMFVQQTNPGNFTILGQPMRVTHLV 438
            |..|:|::        |:...|  .|.|||| .:..|::..:.|:..:..|.|       |...:
Mosquito  3751 QLRLTNAN--------RIPTSGHTFLVSGND-GKHPDVTSTVSVEFLHFDNAT-------VDQSI 3799

  Fly   439 VEAVETAVSENYTQN-----AEVTKIFSKPSKAIIKH-----GKKLRIVCEVSGQPPPKVTWFKD 493
            ...:|...|.|:..|     .::.|...:|:..:|.:     ||.|.:...|...|         
Mosquito  3800 TVRLENISSANFLANYYRNFVDIVKASLEPADDLILYSLLDAGKALHVTLAVRNTP--------- 3855

  Fly   494 EKSINRKRNIYQFKHHKRRSELI---------------VRSFNSSSDAGRYECRAK------NKA 537
            .|....|:  |..:...|:.|.|               .||.::.::.|....|.|      |:.
Mosquito  3856 LKGYRSKQ--YVIERFSRKLEAIGQLLPNVQTTIGYDPCRSADTCANGGVCSARIKVYPEEDNRI 3918

  Fly   538 SKAIA--------------------------KRRIMIKASPVH---------------FPTDRSA 561
            :.:.:                          ||:.....:|.|               .|::|..
Mosquito  3919 TDSQSLIFTSPPVRHDFACACPDGYTGARCDKRQDPCSPNPCHAGGQCRRQGYDFQCTCPSNREG 3983

  Fly   562 S------GIPCNFDYCFHNGTCRMIPDINEVYCRCPTEYFGNRCE 600
            .      |..|:...|.:.|:||...|.:..:|.|...|.||:||
Mosquito  3984 KYCQLERGDICSSGPCKNGGSCRESSDGSSFFCLCRPGYRGNQCE 4028

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706 17/87 (20%)
EGF 566..598 CDD:278437 10/31 (32%)
AgaP_AGAP007924XP_317558.4 Cadherin_repeat 21..104 CDD:206637
Cadherin_repeat 115..218 CDD:206637
Cadherin_repeat 227..331 CDD:206637
Cadherin_repeat 346..443 CDD:206637
Cadherin_repeat 451..547 CDD:206637
Cadherin_repeat 558..656 CDD:206637
Cadherin_repeat 665..755 CDD:206637
Cadherin <816..866 CDD:278457
Cadherin_repeat 890..984 CDD:206637
Cadherin_repeat 992..1089 CDD:206637
Cadherin_repeat 1097..1211 CDD:206637
Cadherin_repeat 1219..1316 CDD:206637
Cadherin_repeat 1327..1422 CDD:206637
Cadherin_repeat 1434..1535 CDD:206637
Cadherin_repeat 1556..1632 CDD:206637
Cadherin_repeat 1652..1751 CDD:206637
Cadherin_repeat 1760..>1834 CDD:206637
Cadherin_repeat 1861..1957 CDD:206637
Cadherin_repeat 1965..2054 CDD:206637
Cadherin_repeat 2107..2204 CDD:206637
Cadherin_repeat 2212..2314 CDD:206637
Cadherin_repeat 2322..2421 CDD:206637
Cadherin_repeat 2429..2526 CDD:206637
Cadherin_repeat 2534..2629 CDD:206637
Cadherin_repeat 2645..2741 CDD:206637
Cadherin_repeat 2750..2844 CDD:206637
Cadherin_repeat 2852..2944 CDD:206637
Cadherin_repeat 2953..3055 CDD:206637
Cadherin_repeat 3064..3162 CDD:206637
Cadherin_repeat 3172..3269 CDD:206637
Cadherin_repeat 3277..3372 CDD:206637
Cadherin_repeat 3381..3479 CDD:206637
Cadherin_repeat 3488..3585 CDD:206637
Cadherin_repeat 3598..3690 CDD:206637
EGF 3955..3985 CDD:278437 4/29 (14%)
EGF_CA 3992..4028 CDD:238011 11/35 (31%)
EGF_CA 4032..4066 CDD:238011
LamG 4094..4254 CDD:304605
LamG 4386..4521 CDD:238058
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.