DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment vn and nrg1

DIOPT Version :9

Sequence 1:NP_523942.2 Gene:vn / 38657 FlyBaseID:FBgn0003984 Length:623 Species:Drosophila melanogaster
Sequence 2:XP_012810561.2 Gene:nrg1 / 100496613 XenbaseID:XB-GENE-1011451 Length:673 Species:Xenopus tropicalis


Alignment Length:35 Identity:14/35 - (40%)
Similarity:22/35 - (62%) Gaps:3/35 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   570 YCFHNGTCRMIPDI---NEVYCRCPTEYFGNRCEN 601
            ||.:.|.|.::..|   |:..|:||.|:.|:||:|
 Frog   221 YCVNGGECYVLNGITSSNQFMCKCPNEFTGDRCQN 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
vnNP_523942.2 IGc2 471..538 CDD:197706
EGF 566..598 CDD:278437 11/30 (37%)
nrg1XP_012810561.2 Neuregulin 296..655 CDD:396641
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2572
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.