powered by:
Protein Alignment vn and nrg1
DIOPT Version :9
Sequence 1: | NP_523942.2 |
Gene: | vn / 38657 |
FlyBaseID: | FBgn0003984 |
Length: | 623 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_012810561.2 |
Gene: | nrg1 / 100496613 |
XenbaseID: | XB-GENE-1011451 |
Length: | 673 |
Species: | Xenopus tropicalis |
Alignment Length: | 35 |
Identity: | 14/35 - (40%) |
Similarity: | 22/35 - (62%) |
Gaps: | 3/35 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 570 YCFHNGTCRMIPDI---NEVYCRCPTEYFGNRCEN 601
||.:.|.|.::..| |:..|:||.|:.|:||:|
Frog 221 YCVNGGECYVLNGITSSNQFMCKCPNEFTGDRCQN 255
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
vn | NP_523942.2 |
IGc2 |
471..538 |
CDD:197706 |
|
EGF |
566..598 |
CDD:278437 |
11/30 (37%) |
nrg1 | XP_012810561.2 |
Neuregulin |
296..655 |
CDD:396641 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X2572 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 1.000 |
|
Return to query results.
Submit another query.