DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cralbp and SEC14L6

Sequence 1:NP_523939.1 Gene:Cralbp FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_016884420.1 Gene:SEC14L6 HGNCID:40047 Length:432 Species:Homo sapiens

Alignment Length:296 Identity:69/297 (23%)
Similarity:111/297 (37%) Gaps:102/297 (34%)


  Fly    29 TREQSLEQLRNWVAKNEDLQNV-----RCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFPHM 88
            ::|:||.|.|      |::|:|     ..||.||||:|:|:.|.:..:|..|.|::..|:. ..:
Human    14 SQEKSLAQFR------ENIQDVLSALPNPDDYFLLRWLQARSFDLQKSEDMLRKHMEFRKQ-QDL 71

  Fly    89 STQLDYLEPRLGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPK--------------IHTSCDQ 139
            :..|.:..|.:..|.:...|..   .|..|..|.......|:||              ...||: 
Human    72 ANILAWQPPEVVRLYNANGICG---HDGEGSPVWYHIVGSLDPKGLLLSASKQELLRDSFRSCE- 132

  Fly   140 AKAHFLTYECLMEDQE---TQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKE- 200
                .|..||.::.|:   |:.||::...|..|  ..:...|.|.:              |||| 
Human   133 ----LLLRECELQSQKPHWTRGTGISAPLDRRG--NCNTAIWPPMD--------------RHKEL 177

  Fly   201 -------------------------IHLI---------NVPSTLKWLI------------DFVKN 219
                                     |.|:         |.|..||.||            :.||:
Human   178 GKRVEKIIAIFGLEGLGLRDLWKPGIELLQEFFSALEANYPEILKSLIVVRAPKLFAVAFNLVKS 242

  Fly   220 RVSSKMKNRLIIYGS--EKELMKSVDQGCLPLEMGG 253
            .:|.:.:.:::|.|.  ::||.|.:....||:|.||
Human   243 YMSEETRRKVVILGDNWKQELTKFISPDQLPVEFGG 278

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 20/52 (38%)
SEC14 101..254 CDD:238099 46/220 (21%)
SEC14L6XP_016884420.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.