DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cralbp and ttpa

Sequence 1:NP_523939.1 Gene:Cralbp FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:XP_012820030.1 Gene:ttpa XenbaseID:XB-GENE-953693 Length:285 Species:Xenopus tropicalis

Alignment Length:264 Identity:71/265 (27%)
Similarity:122/265 (46%) Gaps:7/265 (3%)


  Fly    22 ELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLLKYLNIRRTFP 86
            ||.:......:::..:|.....:..:..:...|.||||||||:.|.:.:|.:.|..|...|...|
 Frog    17 ELPDQAPVVREAISIIRKRAEADSAIWPLGLSDDFLLRFLRARDFCIELAFKLLKNYHKWRAECP 81

  Fly    87 HMSTQLDYLEPR-LGDLIDQGYIFAVPQRDKHGRRVVVINAKGLNPKIHTSCDQAKAHFLTYECL 150
            .::..   |.|. :.||...||...:..||..|.:|::...:..:||:.|:.:..:...:|.|.:
 Frog    82 EITAD---LRPSPILDLFRAGYHAVLRSRDDSGSKVLIYRIEYWDPKLFTAYEVFRVSLITSELI 143

  Fly   151 MEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIHLINVPSTLKWLID 215
            :::.|||..|:..:.|..|...||.....||...||......|.|::.:.:||||.|.....:..
 Frog   144 VQEAETQRNGIKAIFDLQGWRLAHAFQITPTMAKRIAAVMADSFPLKVRGVHLINEPLFFHPVFA 208

  Fly   216 FVKNRVSSKMKNRLIIYGSE--KELMKSVDQGCLPLEMGGKVP-MREMIELWKQELATKRDLILG 277
            .:|..:..|:|.|:.::||.  ..|.:......||.|.||..| |.|:.|.|...:.:..|.:|.
 Frog   209 IIKPFLPDKIKQRVHMHGSNYIPTLNQHFSTSILPPEYGGTGPAMSELCEEWTAHIMSSEDYLLS 273

  Fly   278 LDKS 281
            :.::
 Frog   274 ISQN 277

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 13/47 (28%)
SEC14 101..254 CDD:238099 44/155 (28%)
ttpaXP_012820030.1 CRAL_TRIO_N 27..73 CDD:215024 13/46 (28%)
CRAL_TRIO 99..249 CDD:279044 42/150 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D559280at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.