DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Cralbp and CG33514

Sequence 1:NP_523939.1 Gene:Cralbp FlyBaseID:FBgn0035636 Length:324 Species:Drosophila melanogaster
Sequence 2:NP_001014558.1 Gene:CG33514 FlyBaseID:FBgn0053514 Length:311 Species:Drosophila melanogaster

Alignment Length:318 Identity:85/319 (27%)
Similarity:153/319 (48%) Gaps:21/319 (7%)


  Fly    12 PEALLKIAKRELREDRCTREQSLEQLRNWVAKNEDLQNVRCDDTFLLRFLRAKKFSVPMAEQTLL 76
            || |.|:||.:|:||....|..|:..:.|:.:...| |.|.||.||:.|||..|:|:..|:..|.
  Fly    10 PE-LQKVAKEQLKEDPERLEADLQAFKTWIEQQPHL-NPRMDDQFLVAFLRGCKYSLERAKSKLD 72

  Fly    77 KYLNIRRTFPHMSTQLDYLEPRLGDLIDQGYIFAVP-QRDKHGRRVVVINAKGLNP-KIHT--SC 137
            ||..::..:|......:..:.:..::...|.|..:| ..:::|.|:.:.. .||.| :.:|  .|
  Fly    73 KYYTLKTKYPDYFRVTNTTDSKFREIHQTGAIIYLPTPLNENGPRIGIWR-MGLVPVEKYTMLEC 136

  Fly   138 DQAKAHFLTYECLMEDQETQITGLTHVGDFAGVTTAHVTNWNPTEFARIFKWGEQSLPMRHKEIH 202
            .|. |..:....::||....:.|:..:.|..|.|.||:....|:...:...:.|::||:|.|..|
  Fly   137 MQV-AQAMQEIAILEDDYANVNGVVFIMDMKGATAAHLFQMTPSMAKKFTVFSEEALPLRLKAQH 200

  Fly   203 LINVPSTLKWLIDFVKNRVSSKMKNRLIIYGSEKELMKSVDQGCLPLEMGGKVPMREMIELWKQE 267
            .||..:..:.|.:..|..:|.||::||.::|::..|:..            ::|::.:.|.:..|
  Fly   201 FINTITGFEQLFNMFKPMMSKKMQSRLFVHGNKMGLLTE------------QIPLKYLPEEYGGE 253

  Fly   268 LATKRDLILGLDKSILRSDRGIQRRSSFNAGKA-STGGPNFVSQIESIEGSFRKLEFD 324
            ..|.:|::..::|.:.......|...:|...:: ..|.|.....:..:|||||||..|
  Fly   254 NGTTQDIVAAMEKKLDEYADFFQENVNFGTDESLRPGKPIDFEGLFGVEGSFRKLNVD 311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
CralbpNP_523939.1 CRAL_TRIO_N 31..78 CDD:215024 18/47 (38%)
SEC14 101..254 CDD:238099 38/157 (24%)
CG33514NP_001014558.1 CRAL_TRIO_N 28..74 CDD:215024 18/47 (38%)
SEC14 97..253 CDD:238099 40/170 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1471
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D559280at33208
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR10174
RoundUp 00.000 Not matched by this tool.
33.010

Return to query results.
Submit another query.