DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and PKMYT1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_004194.3 Gene:PKMYT1 HGNCID:29650 Length:499 Species:Homo sapiens

Alignment Length:451 Identity:174/452 (38%)
Similarity:244/452 (54%) Gaps:62/452 (14%)


  Fly    68 ISFRDAGCSDSSTLPS---SPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYA 129
            :|||...   |.||.|   .|.:.|      |.|:|.|:||::||.||:||||:||.:.||:|||
Human    82 VSFRGEA---SETLQSPGYDPSRPE------SFFQQSFQRLSRLGHGSYGEVFKVRSKEDGRLYA 137

  Fly   130 VKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQ 194
            ||.|...|||.:.||.:|.||..:|:...|..|:|..:|||:...||:|.|||..||:|:   |:
Human   138 VKRSMSPFRGPKDRARKLAEVGSHEKVGQHPCCVRLEQAWEEGGILYLQTELCGPSLQQH---CE 199

  Fly   195 ----RIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANS 255
                .:||.::|..|.|.|..|..||.:.|:|||:|..|:.:|.... |||.||||::::..|.:
Human   200 AWGASLPEAQVWGYLRDTLLALAHLHSQGLVHLDVKPANIFLGPRGR-CKLGDFGLLVELGTAGA 263

  Fly   256 HHATEGDSRYMAPEILQGHFSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKI 320
            ....|||.||||||:|||.:..|||:||||:.:||:||.|:||..|..|.:||.|.||.||...:
Human   264 GEVQEGDPRYMAPELLQGSYGTAADVFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGL 328

  Fly   321 SLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSL---MNFSMLSRSFRRSRRAVW--- 379
            |.||:||:..|::|||..|.|||.||:.|.|:  |.:...:   |....|||.:     |:|   
Human   329 SSELRSVLVMMLEPDPKLRATAEALLALPVLR--QPRAWGVLWCMAAEALSRGW-----ALWQAL 386

  Fly   380 -GRMCNWKTAAFRYLLYFLEVLHLCKPIT--ASQPNINIVPSSPSSK------GVPLVPQ-VEFQ 434
             ..:| |......:...:|:.|.  .|.|  .|.|...::.||.||.      |..|.|: |..:
Human   387 LALLC-WLWHGLAHPASWLQPLG--PPATPPGSPPCSLLLDSSLSSNWDDDSLGPSLSPEAVLAR 448

  Fly   435 LVGSTPIANRDCYASDFLSGEDPLDLSNQGSPNVINSTP----LNTNQGKSRLDLLKNNVD 491
            .||||......|      :..|.||||:      |||.|    ..:.:.::.|.|.::.:|
Human   449 TVGSTSTPRSRC------TPRDALDLSD------INSEPPRGSFPSFEPRNLLSLFEDTLD 497

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 121/253 (48%)
Pkinase 102..349 CDD:278497 120/251 (48%)
PKMYT1NP_004194.3 PKc_Myt1 108..357 CDD:270952 121/253 (48%)
Membrane-association motif 382..398 3/17 (18%)
Interaction with PIN1 398..499 31/115 (27%)
Interaction with CDC2-CCNB1 437..499 21/74 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C200302937
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 246 1.000 Inparanoid score I3232
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 1 1.000 T1073502
orthoMCL 1 0.900 OOG5_131219
Panther 1 1.100 LDO PTHR11042
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 1 0.960
User_Submission 00.000 Not matched by this tool.
1110.790

Return to query results.
Submit another query.