DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and ISR1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_015431.1 Gene:ISR1 SGDID:S000006310 Length:443 Species:Saccharomyces cerevisiae

Alignment Length:273 Identity:62/274 (23%)
Similarity:112/274 (41%) Gaps:57/274 (21%)


  Fly   108 LGEGSFGEVFQVRDRSDGQL-----YAVKISKQLFRGEQYRAERLE-EVRRYEEFSGHENCI--- 163
            :|:||:..|:.:...:..:.     ..:|.:|...:.:....|.|. ...:|...|.:|:.|   
Yeast   141 VGQGSYSYVYPISSSASSRCNNDSGVVLKFAKSQHKSKVILQEALTLAYLQYMSPSTNESHIIPF 205

  Fly   164 -----------RFIRAWEQYDRLYMQMELCRESLEQYLL----RCQRIPEERI-WHILLDLLRGL 212
                       |.:|:.|....|.:..  |..||..:..    :...|.:.:| |.::..::..|
Yeast   206 YGLTYITKSHFRRLRSNECVPGLILPK--CEMSLYHFNTAVSHKLSLITKRKIWWRLMKQMIDAL 268

  Fly   213 KSLHDRNLIHLDIKLDNVLIGE----DDETCKLADFGLVIDVDRANSHHATEGDS------RYMA 267
            |||....:||.|||..|:||.|    :...||..||.|   .|..::.|..:..:      .|.|
Yeast   269 KSLKTNGIIHGDIKTANILITEMHVLNGGHCKDFDFYL---ADFTSAFHINQTPTDLNTTVEYCA 330

  Fly   268 PEILQGHFSKA----ADIFSLGIAMLELACYMDLPSNGPLWHELR----HGILPEEFINKISL-E 323
            ||::.......    :|::::|:      |.:...|....::||:    ||..|.  |...|: :
Yeast   331 PELIDSSSDHVPTFESDLYAVGL------CLLSFISQHEPYNELQALVSHGSSPG--IGSSSIQQ 387

  Fly   324 LQSVIKSMMKPDP 336
            .|.:|.:::|.||
Yeast   388 SQWLINALLKKDP 400

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 62/274 (23%)
Pkinase 102..349 CDD:278497 62/274 (23%)
ISR1NP_015431.1 Pkinase 139..400 CDD:278497 61/272 (22%)
PKc 142..372 CDD:270622 52/241 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11042
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.