DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and SWE1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_012348.1 Gene:SWE1 SGDID:S000003723 Length:819 Species:Saccharomyces cerevisiae

Alignment Length:477 Identity:114/478 (24%)
Similarity:185/478 (39%) Gaps:158/478 (33%)


  Fly    23 NGENSNRFRPPKYKTRGYVAVDNNN-------LNRSQSLGSCS----------------TN-SSQ 63
            :..:|.|..|..|:.||  ..||:.       ..|...:|:.|                || :|.
Yeast   345 SSHHSTRKNPQPYQFRG--RYDNDTDEEISTPTRRKSIIGATSQTHRESRPLSLSSAIVTNTTSA 407

  Fly    64 IAHAISFRDAGCSDSSTLPSSPVQA--------ELSTLSLSHFEQCFERLAKLGEGSFGEVFQVR 120
            ..|:||..|          |||:.:        :||....||..:.|..:..:|:|.|..|:||.
Yeast   408 ETHSISSTD----------SSPLNSKRRLISSNKLSANPDSHLFEKFTNVHSIGKGQFSTVYQVT 462

  Fly   121 DRSDGQLYAVKISKQLFRGEQYRAER--LEEVRRYEEFS--------GHENCIRFIRAWEQYDRL 175
            .....:.||:|..|.    .:|.:.:  |.|::...|.:        |.|..|.:|.:|:..:..
Yeast   463 FAQTNKKYAIKAIKP----NKYNSLKRILLEIKILNEVTNQITMDQEGKEYIIDYISSWKFQNSY 523

  Fly   176 YMQMELCRES------LEQYLLRCQRIPEERIWHILLDLLRGLKSLHDR-NLIHLDIKLDNVLIG 233
            |:..|||...      .||.:.:.:|:.:.|||.|:::|...|:.:||. :::|||:|..||:| 
Yeast   524 YIMTELCENGNLDGFLQEQVIAKKKRLEDWRIWKIIVELSLALRFIHDSCHIVHLDLKPANVMI- 587

  Fly   234 EDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQG-HFSKAADIFSLGIAMLELACYMDL 297
            ..:...||.|||:...:...:.....|||..|:||||:.. .:...|||||||:.::|:|..:.|
Yeast   588 TFEGNLKLGDFGMATHLPLEDKSFENEGDREYIAPEIISDCTYDYKADIFSLGLMIVEIAANVVL 652

  Fly   298 PSNGPLWHELRHGIL-------------------------------------------------- 312
            |.||..||:||.|.|                                                  
Yeast   653 PDNGNAWHKLRSGDLSDAGRLSSTDIHSESLFSDITKVDTNDLFDFERDNISGNSNNAGTSTVHN 717

  Fly   313 ---------------------------------------PEEFINKISLELQSVIKSMMKPDPAQ 338
                                                   |:..|:..|||  .:::.|::|:..:
Yeast   718 NSNINNPNMNNGNDNNNVNTAATKNRLILHKSSKIPAWVPKFLIDGESLE--RIVRWMIEPNYER 780

  Fly   339 RPTAEQLLSHPKLQYLQKKRKS 360
            ||||.|:|...:..|::..|.:
Yeast   781 RPTANQILQTEECLYVEMTRNA 802

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 87/356 (24%)
Pkinase 102..349 CDD:278497 87/354 (25%)
SWE1NP_012348.1 PTKc_Wee1_fungi 443..791 CDD:270954 87/355 (25%)
S_TKc 444..>648 CDD:214567 64/209 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C200312012
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 1 1.000 T634601
orthoMCL 1 0.900 OOG5_131219
Panther 1 1.100 LDO PTHR11042
Phylome 1 0.910 0.955 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 00.000 Not matched by this tool.
87.770

Return to query results.
Submit another query.