DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and WEE1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_171796.1 Gene:WEE1 AraportID:AT1G02970 Length:500 Species:Arabidopsis thaliana

Alignment Length:325 Identity:108/326 (33%)
Similarity:161/326 (49%) Gaps:34/326 (10%)


  Fly    29 RFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSSTLPSSPVQAELSTL 93
            |..||......||      ||:|:      |.:....|    :.:.|  :|.||.|     .|..
plant   199 RAMPPPCLKNPYV------LNQSE------TATDPFGH----QRSKC--ASFLPVS-----TSGD 240

  Fly    94 SLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSG 158
            .||.:...|..:.::|.|.|..||:|..|.||.|||||.|.:....:..|.:.:.||:.......
plant   241 GLSRYLTDFHEIRQIGAGHFSRVFKVLKRMDGCLYAVKHSTRKLYLDSERRKAMMEVQALAALGF 305

  Fly   159 HENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQ-RIPEERIWHILLDLLRGLKSLHDRNLIH 222
            |||.:.:..:|.:.::||:|:|||..||.....:.. ::.|..|..|:..:.:.|..:|::.:.|
plant   306 HENIVGYYSSWFENEQLYIQLELCDHSLSALPKKSSLKVSEREILVIMHQIAKALHFVHEKGIAH 370

  Fly   223 LDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQ---GHFSKAADIFSL 284
            ||:|.||:.|  .:..|||.|||....:|:  |....|||:|||..|||.   .|..| .|||||
plant   371 LDVKPDNIYI--KNGVCKLGDFGCATRLDK--SLPVEEGDARYMPQEILNEDYEHLDK-VDIFSL 430

  Fly   285 GIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHP 349
            |:.:.||.....|..:......::.|.||  .:...||:||.::|:||..||.:||:|.:||.||
plant   431 GVTVYELIKGSPLTESRNQSLNIKEGKLP--LLPGHSLQLQQLLKTMMDRDPKRRPSARELLDHP 493

  Fly   350  349
            plant   494  493

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 89/253 (35%)
Pkinase 102..349 CDD:278497 89/251 (35%)
WEE1NP_171796.1 PKc_Wee1_like 248..493 CDD:270899 89/252 (35%)
S_TKc 249..495 CDD:214567 90/253 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11042
Phylome 00.000 Not matched by this tool.
22.110

Return to query results.
Submit another query.