DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and WEE2

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001099028.1 Gene:WEE2 HGNCID:19684 Length:567 Species:Homo sapiens

Alignment Length:317 Identity:96/318 (30%)
Similarity:155/318 (49%) Gaps:37/318 (12%)


  Fly    96 SHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGHE 160
            |.:|:.|..:.|:|.|.||.|::...|.||.:||:|.|.:.|.........|.||..:.....|.
Human   206 SRYEKEFLEVEKIGVGEFGTVYKCIKRLDGCVYAIKRSMKTFTELSNENSALHEVYAHAVLGHHP 270

  Fly   161 NCIRFIRAWEQYDRLYMQMELC-----RESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNL 220
            :.:|:..:|.:.|.:.:|.|.|     :.::.:.........|.::..|||.:..||..:|:.::
Human   271 HVVRYYSSWAEDDHMIIQNEYCNGGSLQAAISENTKSGNHFEEPKLKDILLQISLGLNYIHNSSM 335

  Fly   221 IHLDIKLDNVLI---------GEDDETCKLADFGLVIDV--DRANSHHAT--------EGDSRYM 266
            :|||||..|:.|         |..:|....||:.|..:|  ...:..|||        |||||::
Human   336 VHLDIKPSNIFICHKMQSESSGVIEEVENEADWFLSANVMYKIGDLGHATSINKPKVEEGDSRFL 400

  Fly   267 APEILQ---GHFSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVI 328
            |.||||   .|..| ||||:||:.:...|....||:||..||.:|.|..| :...::|....|::
Human   401 ANEILQEDYRHLPK-ADIFALGLTIAVAAGAESLPTNGAAWHHIRKGNFP-DVPQELSESFSSLL 463

  Fly   329 KSMMKPDPAQRPTAEQL----LSHPKLQYLQKKRKSL----MNFSMLSRSFRRSRRA 377
            |:|::||..|||:|..|    :..|.|...::.::.|    ...:.|.|..|.:::|
Human   464 KNMIQPDAEQRPSAAALARNTVLRPSLGKTEELQQQLNLEKFKTATLERELREAQQA 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 87/280 (31%)
Pkinase 102..349 CDD:278497 87/278 (31%)
WEE2NP_001099028.1 Nuclear localization signal. {ECO:0000250} 173..175
PTKc_Wee1b 211..485 CDD:271041 87/276 (32%)
Pkinase 212..480 CDD:278497 86/270 (32%)
Nuclear export signal. {ECO:0000250} 315..329 5/14 (36%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.