DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and Gcn2

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001263142.1 Gene:Gcn2 FlyBaseID:FBgn0019990 Length:1591 Species:Drosophila melanogaster

Alignment Length:474 Identity:101/475 (21%)
Similarity:163/475 (34%) Gaps:191/475 (40%)


  Fly    35 YKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAI--SFRDAGCSDSSTLP-------------SS 84
            |:.|.:  ||..|.:|:.|.      |..:.|..  .:.|.|......||             :.
  Fly   451 YEMRDF--VDKCNSDRTLSA------SELLEHPFLRFYVDNGQQQVMPLPQQQHPNTVQRTGSAM 507

  Fly    85 PVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVK------ISKQLFRGEQYR 143
            |.|.....||.|.....||.|..||:|:||:|.:||:..|.:.||:|      .|:||::.....
  Fly   508 PYQIPTLALSQSRLRTEFEVLMYLGKGAFGDVLKVRNILDNREYAIKRIPLPARSRQLYKKMTRE 572

  Fly   144 AERLEEVRRYEEFSGHENCIRFIRAW--------------------------------------- 169
            .|.|..:       .|||.:|:..:|                                       
  Fly   573 VELLSRL-------NHENVVRYFNSWIESVDDADAAEMDKLLGGEWSQSQQDLSVKPAKSPQLGP 630

  Fly   170 ----------------------------------------------EQYDR-------------- 174
                                                          ||.|.              
  Fly   631 TLEEDEDEEDSSSSMWNGYIPNMEDSDSDGIEFVDSNGKVAVYDDEEQEDSTRGKTNSPKPLMQV 695

  Fly   175 LYMQMELC-----RESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGE 234
            :|:|||.|     |.:::..|..    ..:|:|.:..::..||..:|.:.:||.|:|..|:.:..
  Fly   696 MYIQMEFCEKCTLRTAIDDNLFN----DTDRLWRLFREIAEGLAHIHQQGIIHRDLKPVNIFLDS 756

  Fly   235 DDETCKLADFGLVI---------DVDRANSHHATE----------GDSRYMAPEILQGHFSKA-- 278
            .|: .|:.||||..         |...|..:..|.          |.:.|:||| |.|:.||:  
  Fly   757 HDQ-IKIGDFGLATTSFLALQAHDAAPAPVNQITSAEDGTGTGKVGTTLYVAPE-LTGNASKSVY 819

  Fly   279 ---ADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQ-------------SV 327
               .|:::|||.:.|: |.....::    .|....|:.   :..:|:.:.             .:
  Fly   820 NQKVDMYTLGIILFEM-CQPPFDTS----MERAQTIMA---LRNVSINIPDAMLKDPKYEKTVKM 876

  Fly   328 IKSMMKPDPAQRPTAEQLL 346
            ::.::..|||||||||:||
  Fly   877 LQWLLNHDPAQRPTAEELL 895

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 83/395 (21%)
Pkinase 102..349 CDD:278497 83/393 (21%)
Gcn2NP_001263142.1 RWD 17..130 CDD:214735
PK_eIF2AK_GCN2_rpt1 261..476 CDD:270914 9/33 (27%)
STKc_EIF2AK4_GCN2_rpt2 518..898 CDD:270948 84/400 (21%)
S_TKc 525..895 CDD:214567 82/391 (21%)
HisS 974..1414 CDD:223202
class_II_aaRS-like_core 974..>1137 CDD:294192
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83468345
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11042
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.