DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and PEK

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_649538.1 Gene:PEK FlyBaseID:FBgn0037327 Length:1162 Species:Drosophila melanogaster

Alignment Length:395 Identity:92/396 (23%)
Similarity:151/396 (38%) Gaps:95/396 (24%)


  Fly    14 DDKHRHKQCNGENSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDS 78
            ||....::..|::..|.|..........:.|..|:|.||.  ...:||.|| .::..:.:|..|:
  Fly   820 DDYEEDEEQQGDHEKRHRSSVSIDIHSASFDLKNINYSQH--QLVSNSFQI-ESVRPKSSGSDDA 881

  Fly    79 STLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYR 143
            :  ..:..:.:..||:|:                     |..:.:.........|..:..|...:
  Fly   882 N--DDNKARRKPLTLALA---------------------QNHNNNQNGSQPTPSSATILNGTVAK 923

  Fly   144 AERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCR-ESLEQYL------LRCQRIPEERI 201
            ..::                          .||:||:||| |||..:|      .|...|.:  |
  Fly   924 PSKV--------------------------YLYIQMQLCRKESLRDWLRDNRSETRAAHIGD--I 960

  Fly   202 WHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDV-----------DRAN- 254
            :|.::|   .:..:|.:.|||.|:|..|:...:|.: .|:.|||||.|:           |::. 
  Fly   961 FHQIVD---AVDYVHLKGLIHRDLKPSNIFFSQDGQ-IKIGDFGLVTDMADIPNLVAKCGDQSGL 1021

  Fly   255 ----SHHATEGDSRYMAPEILQG-HFSKAADIFSLGIAMLELACYMDLPSNG-PLWHELRHGILP 313
                .|....|...||:||.|.| |:....||:|||:...||..|....... .....||.|..|
  Fly  1022 PSCARHTQQVGTHLYMSPEQLLGQHYDYKVDIYSLGLIFFELHVYFSTEMERIKTLRSLRDGQYP 1086

  Fly   314 EEFINKISLELQ-SVIKSMMKPDPAQRPTAEQLLSH-------PKLQYLQKKRKSLMNFSMLSRS 370
            ::|  .::...| .:::.|:...|.|||..:||.|.       |.|  |.:.:......:..:|.
  Fly  1087 KDF--AVNYPQQYDLLQQMLSAQPEQRPQTKQLKSQLRNILQLPHL--LSEGQSEQAELAERARR 1147

  Fly   371 FRRSR 375
            ..|||
  Fly  1148 LSRSR 1152

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 66/282 (23%)
Pkinase 102..349 CDD:278497 66/280 (24%)
PEKNP_649538.1 Luminal_EIF2AK3 73..401 CDD:188874
PKc_like 635..1113 CDD:304357 82/353 (23%)
S_TKc <925..1118 CDD:214567 62/227 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83429087
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11042
RoundUp 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.