DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and Wee2

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_958758.2 Gene:Wee2 MGIID:3027899 Length:555 Species:Mus musculus

Alignment Length:431 Identity:112/432 (26%)
Similarity:182/432 (42%) Gaps:103/432 (24%)


  Fly     3 KHHRLPLPELHDDKHRHKQCNGENSNRFRPPKY-----------KTRGYVAVDNNNLNRSQSLGS 56
            :|.||....|.|:|   ...:..|.|.|.|..|           |||.|:               
Mouse   128 RHMRLTPASLMDEK---TSLSLVNINPFTPETYRKLLLQSKGKRKTRDYL--------------- 174

  Fly    57 CSTNSSQIAHAISFRDAGCSDSSTLPSSPVQAEL--STLSLSHFEQCFERLAKLGEGSFGEVFQV 119
                          .:.|..:|.::...|.:..:  .|...|.:|:.|..:.|:|.|.||.|::.
Mouse   175 --------------EETGEEESKSVQWLPAKRSILQETNMASRYEKEFFEIEKIGVGEFGTVYKC 225

  Fly   120 RDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELC-- 182
            ..|.||.:||:|.|.:.|.|.....: |.||..:.....|.:.:|:..:|.:.|.:.:|.|.|  
Mouse   226 IKRLDGCIYAIKRSAKSFSGLSNELD-LHEVYAHAVLGHHPHVVRYYSSWIEDDHVVIQNEYCNG 289

  Fly   183 ---RESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLI-----------G 233
               :.::.:.........|.::..|||.:..|||.:|:..::|||||..|:.|           .
Mouse   290 GSLQAAISENTASNNHFQEPKLKDILLQISLGLKYIHNSGMVHLDIKPSNIFICHKMQCDSPVGP 354

  Fly   234 EDDET-----------CKLADFGLVIDVDRANSHHAT--------EGDSRYMAPEILQGHFS--K 277
            |:.|:           .|:.|.|           |||        |||:|::|.||||.::.  .
Mouse   355 EEAESEADWFLNASVMYKIGDLG-----------HATSISKPKVEEGDTRFLANEILQENYQHLP 408

  Fly   278 AADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTA 342
            .||||:||:.:...|....||.||.:||.:|.|..| |...::|.:...::|:|:.|.|.:||:|
Mouse   409 KADIFALGLTIAVAAGAESLPINGDMWHHIRKGNFP-EISQELSDDFYGLLKNMIHPAPKERPSA 472

  Fly   343 EQL----LSHPKLQYLQKKRKSL----MNFSMLSRSFRRSR 375
            ..|    :..|.|:...:.:|.|    ...:.|.|..:::|
Mouse   473 AALARSRILWPFLEKTDELQKQLNLEKSKTATLKRELKKAR 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 84/290 (29%)
Pkinase 102..349 CDD:278497 84/288 (29%)
Wee2NP_958758.2 Nuclear localization signal 167..169 0/2 (0%)
PKc_like 207..477 CDD:304357 84/283 (30%)
Pkinase 211..475 CDD:278497 82/277 (30%)
Nuclear export signal 310..324 6/14 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.