DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and Wee1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001260167.1 Gene:Wee1 FlyBaseID:FBgn0011737 Length:609 Species:Drosophila melanogaster

Alignment Length:438 Identity:122/439 (28%)
Similarity:190/439 (43%) Gaps:86/439 (20%)


  Fly     2 EKHHRLPLPELHDDKHRHKQCNGE--NSNRFRPP------KYKTRGYVAVDNNNLNRSQSLGSCS 58
            |:...|||       |..|....:  |.|.|.|.      |.:.|.....:|.|||         
  Fly   141 ERPRSLPL-------HNRKLPTQDTANVNPFTPDSLMAHNKKRCRTQFGRENLNLN--------- 189

  Fly    59 TNSSQIAHAISFRDAGCSDSSTLPS----------SPVQAELSTLSLSHFEQCFERLAKLGEGSF 113
            .|:.| .:.:|  || |.|..|..:          :|.:..|...::|.|::.|.::..:|.|.|
  Fly   190 VNAMQ-KYLLS--DA-CDDDVTEEAGDSMREIHQQAPKRLALHDTNISRFKREFMQVNVIGVGEF 250

  Fly   114 GEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQ 178
            |.|||..:|.||.:||:|.||:...|..:....|.||..:.....|:|.:|:..||.:.|.:.:|
  Fly   251 GVVFQCVNRLDGCIYAIKKSKKPVAGSSFEKRALNEVWAHAVLGKHDNVVRYYSAWAEDDHMLIQ 315

  Fly   179 MELCRESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLI----------- 232
            .|.|........::...:.|..:..:|:.::.||:.:|..:|:|:|:|.:|:..           
  Fly   316 NEFCDGGSLHARIQDHCLGEAELKIVLMHVIEGLRYIHSNDLVHMDLKPENIFSTMNPNAHKLVE 380

  Fly   233 -----GEDDE----------------TCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGHFS 276
                 .:||:                |.|:.|.|.|..|   ...:..|||.||:..|||...:|
  Fly   381 VQPQQTKDDDGMDSVYEELRHSENLVTYKIGDLGHVTSV---KEPYVEEGDCRYLPKEILHEDYS 442

  Fly   277 K--AADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQR 339
            .  .||||||||.:.|.|....||.|||.||.||.|.:|  .:..:|.:...:|..||.|.|.:|
  Fly   443 NLFKADIFSLGITLFEAAGGGPLPKNGPEWHNLRDGKVP--ILPSLSRDFNELIAQMMHPYPDKR 505

  Fly   340 PTAEQLLSHPKLQYLQKKRKSLMNFSM---------LSRSFRRSRRAV 378
            ||::.:.|||.|..:..|.|..:...:         |....|.:::.:
  Fly   506 PTSQSIFSHPILSAVDSKSKLQLGLELTVEKRKNEILMNKLREAKKQI 553

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 88/283 (31%)
Pkinase 102..349 CDD:278497 88/281 (31%)
Wee1NP_001260167.1 PTKc_Wee1 238..516 CDD:270953 89/283 (31%)
Pkinase 239..515 CDD:278497 88/281 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C83235347
eggNOG 1 0.900 E1_KOG0601
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR11042
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
54.970

Return to query results.
Submit another query.