DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and wee2

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001038367.1 Gene:wee2 ZFINID:ZDB-GENE-030131-5682 Length:532 Species:Danio rerio

Alignment Length:465 Identity:130/466 (28%)
Similarity:198/466 (42%) Gaps:121/466 (26%)


  Fly    26 NSNRFRP-------PKYKTRGYVAVDNNNLN-RSQSLGSCSTNSSQIAHAISFRDAGCSDSSTLP 82
            |.|.|.|       ..||.:...:.|:.:.. ||:.:    .|||:            .:|..||
Zfish   122 NINPFTPDTVRRNSEHYKRKSQRSDDDEDYGPRSKEI----QNSSE------------DESFFLP 170

  Fly    83 SSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERL 147
            |.  :..:|...||.:|..|..||.:|.|.||.|::...|.||.:||:|.|::...|.......|
Zfish   171 SK--RPAVSARMLSRYESEFLELACIGVGEFGSVYRCVKRLDGCMYAIKRSRRPIAGSANEQLAL 233

  Fly   148 EEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELC------------RESLEQYLLRCQRIPEER 200
            :||..:.....|.:.:|:..||.:.|.:.:|.|.|            ||..|.:     .:||.|
Zfish   234 KEVYAHAVLGHHPHVVRYYSAWAEDDHMIIQNEYCDGGSLHDAITEKREQGEFF-----SVPELR 293

  Fly   201 IWHILLDLLRGLKSLHDRNLIHLDIKLDNVLI--------------GEDDET------CKLADFG 245
              .:||.:..|||.:|:..|:|||||..|:.|              .|:||:      .|:.|.|
Zfish   294 --DLLLQVSMGLKYIHNSGLVHLDIKPSNIFICRRSTLSAGGEGDSEEEDESHSSGVVYKIGDLG 356

  Fly   246 LVIDVDRANSHHATEGDSRYMAPEILQ---GHFSKAADIFSLGIAMLELACYMDLPSNGPLWHEL 307
            .|..:   :|....|||||::|.|:|:   .|..| ||||:||:.:|..|....||.||..||.|
Zfish   357 HVTSI---SSPQVEEGDSRFLAYEVLREDYTHLPK-ADIFALGLTVLLAAGASPLPQNGDDWHRL 417

  Fly   308 RHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHP--------KLQYLQKKRKSLMNF 364
            |.|.|| ...:::....:.::||::.|||..||:|..|..|.        ||....:|..::..|
Zfish   418 RQGELP-NLPHELPALFKDLLKSLLDPDPTARPSATALCRHDVLCKERAGKLATQLRKELNVEKF 481

  Fly   365 --SMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLEVLHLCKPITASQPNINIVPSSPSSKGVPL 427
              :||.|..:.:|                              :.|:.|..:..|.|        
Zfish   482 RTAMLERELKEAR------------------------------LAATSPQQSCQPGS-------- 508

  Fly   428 VPQVEFQLVG 437
            :|:.:.:|||
Zfish   509 LPKAKRKLVG 518

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 94/284 (33%)
Pkinase 102..349 CDD:278497 94/282 (33%)
wee2NP_001038367.1 PTKc_Wee1b 187..459 CDD:271041 94/284 (33%)
Pkinase 194..460 CDD:278497 91/278 (33%)
SPX 433..>516 CDD:271919 23/121 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.