DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and wee1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001296364.1 Gene:wee1 ZFINID:ZDB-GENE-030131-5268 Length:612 Species:Danio rerio

Alignment Length:373 Identity:111/374 (30%)
Similarity:171/374 (46%) Gaps:37/374 (10%)


  Fly    26 NSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSSTLPSSPVQAEL 90
            |.|.|.|.....:. ..:..||..||....||..:       :...||...|....||..: ..:
Zfish   198 NINPFTPDSILVQS-STLQRNNRKRSHWNDSCGED-------MDASDAEIEDELIPPSKRI-TMM 253

  Fly    91 STLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEE 155
            ....:|.:...|..|.|:|.|.||.||:...|.||.:||:|.||:...|.......|.||..:..
Zfish   254 ENNMMSRYASEFHELEKIGSGQFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNALREVYAHAV 318

  Fly   156 FSGHENCIRFIRAWEQYDRLYMQMELCR-----ESLEQYLLRCQRIPEERIWHILLDLLRGLKSL 215
            ...|.:.:|:..||.:.|.:.:|.|.|.     :.:.:...|...:.|..:..:||.:.||||.:
Zfish   319 LGQHPHVVRYYSAWAEDDHMLIQNEYCNGGTLSDVIAENNRRMHFLSELELKDLLLQVSRGLKYI 383

  Fly   216 HDRNLIHLDIKLDNVLIG----------EDDE-------TCKLADFGLVIDVDRANSHHATEGDS 263
            |...|:|:|||..|:.|.          ||:|       ..|:.|.|.|..|   .:....||||
Zfish   384 HSTALVHMDIKPSNIFISRKPAASVEEFEDEEDGPTTNVVYKIGDLGHVTTV---TNPQVEEGDS 445

  Fly   264 RYMAPEILQGHFS--KAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQS 326
            |::|.|:||..:|  |.||||:|.:.::..:....||:||..||::|.|||| .....:|.|..|
Zfish   446 RFLANEVLQEDYSNLKKADIFALALTVVSASGAEPLPTNGDKWHKIRQGILP-HIPQVLSQEFLS 509

  Fly   327 VIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRRS 374
            ::|.|:.|||.:||:..:|:.||.|....:.....:...:.:..|:.:
Zfish   510 LLKLMIHPDPTRRPSTSELVRHPVLLTASRMSADQLRVELNAEKFKNA 557

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 92/273 (34%)
Pkinase 102..349 CDD:278497 92/271 (34%)
wee1NP_001296364.1 PKc_like 259..533 CDD:304357 94/278 (34%)
Pkinase 265..534 CDD:278497 93/273 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.040

Return to query results.
Submit another query.