powered by:
Protein Alignment Myt1 and vito
DIOPT Version :9
| Sequence 1: | NP_647987.2 |
Gene: | Myt1 / 38649 |
FlyBaseID: | FBgn0040298 |
Length: | 533 |
Species: | Drosophila melanogaster |
| Sequence 2: | NP_729096.1 |
Gene: | vito / 326214 |
FlyBaseID: | FBgn0052418 |
Length: | 264 |
Species: | Drosophila melanogaster |
| Alignment Length: | 98 |
Identity: | 28/98 - (28%) |
| Similarity: | 42/98 - (42%) |
Gaps: | 29/98 - (29%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 76 SDSSTLPSSPVQAEL------STLSLSHFEQCF---ERLAKLGEGSFGEVFQVRDRSDGQLYAVK 131
|::||||....:.:| .||...|..:.| |||.|.......: |||:: .:|
Fly 170 SNNSTLPDIKSKKDLDRLMKTKTLKKMHQSKLFKQKERLDKKNNQKKAK----RDRNN----TIK 226
Fly 132 I-----SKQLFRGE----QYRAERL---EEVRR 152
. .|||..|: :||..|: :|:||
Fly 227 SVPKHQRKQLKYGKANQTKYRKGRMVNKKELRR 259
|
Known Domains:
Indicated by green bases in alignment.
| Gene | Sequence | Domain | Region |
External ID | Identity |
| Myt1 | NP_647987.2 |
PKc_Myt1 |
100..349 |
CDD:270952 |
19/68 (28%) |
| Pkinase |
102..349 |
CDD:278497 |
19/66 (29%) |
| vito | NP_729096.1 |
Nop25 |
2..149 |
CDD:286843 |
|
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
| Tool |
Simple Score |
Weighted Score |
Original Tool Information |
| BLAST Result |
Score |
Score Type |
Cluster ID |
| Compara |
0 | 0.000 |
Not matched by this tool. |
| Domainoid |
0 | 0.000 |
Not matched by this tool. |
| eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG0601 |
| Homologene |
0 | 0.000 |
Not matched by this tool. |
| Inparanoid |
0 | 0.000 |
Not matched by this tool. |
| Isobase |
0 | 0.000 |
Not matched by this tool. |
| OMA |
0 | 0.000 |
Not matched by this tool. |
| OrthoDB |
0 | 0.000 |
Not matched by this tool. |
| OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
| OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
| orthoMCL |
0 | 0.000 |
Not matched by this tool. |
| Panther |
0 | 0.000 |
Not matched by this tool. |
| Phylome |
0 | 0.000 |
Not matched by this tool. |
| RoundUp |
0 | 0.000 |
Not matched by this tool. |
| SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.