DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and Wee1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001012760.1 Gene:Wee1 RGDID:1307895 Length:646 Species:Rattus norvegicus

Alignment Length:383 Identity:111/384 (29%)
Similarity:169/384 (44%) Gaps:62/384 (16%)


  Fly    17 HRHKQCNGENSNRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSSTL 81
            |...||.|           :.|.|....:.::..|.               ..|.|      .|.
  Rat   246 HSSGQCRG-----------RKRAYFNDSSEDMEASD---------------YEFED------ETR 278

  Fly    82 PSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAER 146
            |:..:....|.:. |.:...|..|.|:|.|.||.||:...|.||.:||:|.||:...|.......
  Rat   279 PAKRITITESNMK-SRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYAIKRSKKPLAGSVDEQNA 342

  Fly   147 LEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCR-ESLEQYLLRCQRI----PEERIWHILL 206
            |.||..:.....|.:.:|:..||.:.|.:.:|.|.|. .||...:....|:    .|..:..:||
  Rat   343 LREVYAHAVLGQHPHVVRYFSAWAEDDHMLIQNEYCNGGSLADAVSENYRVMSYFTEAELKDLLL 407

  Fly   207 DLLRGLKSLHDRNLIHLDIKLDNVLI------------GEDDE------TCKLADFGLVIDVDRA 253
            .:.|||:.:|..:|:|:|||..|:.|            |::|:      ..|:.|.|   .|.|.
  Rat   408 QVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAVSEEGDEDDWISNKVMFKIGDLG---HVTRI 469

  Fly   254 NSHHATEGDSRYMAPEILQGHFS--KAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEF 316
            :|....|||||::|.|:||.::|  ..||||:|.:.::..|....||.||..|||:|.|.|| ..
  Rat   470 SSPQVEEGDSRFLANEVLQENYSHLPKADIFALALTVVCAAGAEPLPRNGDQWHEIRQGRLP-RI 533

  Fly   317 INKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRRS 374
            ...:|.||..::|.|:.|||.:||:|..|:.|..|....:|....:...:.:..|:.|
  Rat   534 PQVLSQELTELLKVMIHPDPERRPSAMVLVKHSVLLSASRKSAEQLRIELNAEKFKNS 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 94/274 (34%)
Pkinase 102..349 CDD:278497 94/272 (35%)
Wee1NP_001012760.1 PTKc_Wee1a 292..567 CDD:271040 95/279 (34%)
Pkinase 298..568 CDD:278497 94/274 (34%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.