DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and Pkmyt1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_001099236.1 Gene:Pkmyt1 RGDID:1305434 Length:490 Species:Rattus norvegicus

Alignment Length:496 Identity:177/497 (36%)
Similarity:259/497 (52%) Gaps:78/497 (16%)


  Fly    28 NRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSSTLPS---SPVQAE 89
            :|..||:...:|.:.|  :.|...::.|.......:::..       |..|.||.|   .|.:.|
  Rat    39 SRSLPPRPPAKGSIPV--SRLFPPRTPGWQQPQPRRVSFL-------CETSETLQSPGYDPSRPE 94

  Fly    90 LSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYE 154
                  |.|:|.|:||::||.||:||||:||.:.||:|||||.|...|||.:.|..:|.||..:|
  Rat    95 ------SFFQQNFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRSMSPFRGPKDRTRKLAEVGGHE 153

  Fly   155 EFSGHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQ----RIPEERIWHILLDLLRGLKSL 215
            :...|.:|:|..||||:...||:|.|||..||:|:   |:    .:||.::|..|.|.|..|..|
  Rat   154 KVGQHPHCVRLERAWEEGGILYLQTELCGPSLQQH---CEAWGASLPEAQVWGYLRDTLLALDHL 215

  Fly   216 HDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGHFSKAAD 280
            |.:.|:|||:|..|:.:|.... |||.||||::::..|.:..|.|||.||||||:|:|.:..|||
  Rat   216 HSQGLVHLDVKPANIFLGPRGR-CKLGDFGLLVELGSAGAGEAQEGDPRYMAPELLRGSYGTAAD 279

  Fly   281 IFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQL 345
            :||||:.:||:||.|:||..|..|.:||.|.||.||...:|.||:||:..|::|||..|.|||.|
  Rat   280 VFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLTMMLEPDPQLRATAEVL 344

  Fly   346 LSHPKLQYLQKKRKSL---MNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFL--EVLHLCK- 404
            |:.|.|:  |.:..::   |....|||.:     |:|        .|...||.:|  .::|... 
  Rat   345 LALPMLR--QPRPWNVLWYMAAEALSRGW-----ALW--------QALVTLLCWLWHGLVHPASW 394

  Fly   405 ------PIT--ASQPNINIVPSSPSSK------GVPLVPQVEFQLV---GSTPIANRDCYASDFL 452
                  |.|  .|.|...::.|:.||.      |..|.|:.....:   .|||   |..|     
  Rat   395 LQPPGPPATPPGSPPCSPLLDSTLSSNWDDDSIGPSLSPETILSRITRRTSTP---RGRY----- 451

  Fly   453 SGEDPLDLSNQGS--PNVINSTPLNTNQGKSRLDLLKNNVD 491
            :..|.|||::..|  |.    .|..|.:.::.|.|.::::|
  Rat   452 TPRDVLDLTDMDSEPPR----GPCPTFEPRNLLSLFEDSLD 488

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 121/253 (48%)
Pkinase 102..349 CDD:278497 120/251 (48%)
Pkmyt1NP_001099236.1 PKc_Myt1 99..348 CDD:270952 121/253 (48%)
S_TKc 101..350 CDD:214567 121/253 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C200305830
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 246 1.000 Inparanoid score I3141
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 1 1.000 T1087149
orthoMCL 1 0.900 OOG5_131219
Panther 1 1.100 LDO PTHR11042
Phylome 1 0.910 0.667 Consistency score
TreeFam 1 0.960
109.760

Return to query results.
Submit another query.