DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and Pkmyt1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_006524373.1 Gene:Pkmyt1 MGIID:2137630 Length:539 Species:Mus musculus

Alignment Length:483 Identity:174/484 (36%)
Similarity:245/484 (51%) Gaps:75/484 (15%)


  Fly    28 NRFRPPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSSTLPS---SPVQAE 89
            :|..||:...:|.:.|  :.|...::.|.......:::..       |..|..|.|   .|.:.|
Mouse    88 SRSLPPRPPAKGCIPV--SRLFPPRTPGWHQPQPRRVSFL-------CETSEPLQSPGYDPSRPE 143

  Fly    90 LSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYE 154
                  |.|:|.|:||::||.||:||||:||.:.||:|||||.....|||.:.|..:|.||..:|
Mouse   144 ------SFFQQNFQRLSRLGHGSYGEVFKVRSKEDGRLYAVKRYMSPFRGPKDRTRKLAEVGGHE 202

  Fly   155 EFSGHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQ----RIPEERIWHILLDLLRGLKSL 215
            :...|.:|:|..||||:...||:|.|||..||:|:   |:    .:||.::|..|.|:|..|..|
Mouse   203 KVGQHPHCVRLERAWEEGGILYLQTELCGPSLQQH---CEAWGASLPEAQVWGYLRDILLALDHL 264

  Fly   216 HDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGHFSKAAD 280
            |.:.|:|||:|..|:.:|.... |||.||||::::..|.:..|.|||.||||||:|||.:..|||
Mouse   265 HSQGLVHLDVKPANIFLGPRGR-CKLGDFGLLVELGSAGAGEAQEGDPRYMAPELLQGSYGTAAD 328

  Fly   281 IFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQL 345
            :||||:.:||:||.|:||..|..|.:||.|.||.||...:|.||:||:..|::|||..|.|||.|
Mouse   329 VFSLGLTILEVACNMELPHGGEGWQQLRQGYLPPEFTAGLSSELRSVLAMMLEPDPQLRATAEAL 393

  Fly   346 LSHPKLQYLQKKRKSL---MNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLEVLH-LCKPI 406
            |:.|.|:  |.:..::   |....|||.:     |:|        .|...||.:|  .| |..|.
Mouse   394 LALPMLR--QPRPWNVLWYMAAEALSRGW-----ALW--------QALVTLLCWL--WHGLVHPA 441

  Fly   407 TASQPNINIVPSSPSSKGVPLVPQVEFQLVGSTPIANRDCYASDFLSGEDPLDLSNQGSPNVI-- 469
            :..||           .|.|..|.      ||.|.:  ....|...|..|...:....||..:  
Mouse   442 SWLQP-----------PGPPATPP------GSPPCS--PLLDSTLSSSWDNDSIGPSLSPETVLS 487

  Fly   470 -----NSTPLNTNQGKSRLDLLKNNVDS 492
                 .|||......:..|||  .:|||
Mouse   488 RITRRTSTPRGRYIPRDALDL--TDVDS 513

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 121/253 (48%)
Pkinase 102..349 CDD:278497 120/251 (48%)
Pkmyt1XP_006524373.1 PKc_Myt1 148..397 CDD:270952 121/253 (48%)
S_TKc 150..399 CDD:214567 121/253 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C200306390
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 1 1.000 T1083588
orthoMCL 1 0.900 OOG5_131219
Panther 1 1.100 LDO PTHR11042
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 1 0.960
109.740

Return to query results.
Submit another query.