DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and mik1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_595093.1 Gene:mik1 PomBaseID:SPBC660.14 Length:581 Species:Schizosaccharomyces pombe

Alignment Length:416 Identity:107/417 (26%)
Similarity:176/417 (42%) Gaps:88/417 (21%)


  Fly    19 HKQCNGENSNRFRPPK---YKTRGYVA-------------VDNNNLNRS------QSLGSCSTNS 61
            |..|......:.:||:   ..|...:|             :|:.|.:.|      :.|.|.|..|
pombe   158 HTPCKKGTKIKLKPPQSPLSPTTSLLARKCKHIDLDTFSRLDHPNSDSSDETFEMEELPSLSYGS 222

  Fly    62 SQIAHAISFRDAGC---------------------SDSSTLPSSPVQAELSTLSLSHFEQ----- 100
            ..:   :.|.:..|                     |..|..|:||:...::  |...:|:     
pombe   223 EDL---LEFCETPCKSQPIFLSSSHVNNWDEKDVPSSLSWTPTSPIFLNIN--SADDYEEEEDWT 282

  Fly   101 -----CFERLAKLGEGSFGEVFQVR--DRSDGQLYAVKISKQ---LFRGEQYRAERLEEVRRYEE 155
                 .|:::..:.|..|..|:.|.  :.....:|.||:.|:   .|.|::   ..|:||...:.
pombe   283 SDLRIRFQQVKPIHESDFSFVYHVSSINPPTETVYVVKMLKKNAAKFTGKE---RHLQEVSILQR 344

  Fly   156 FSGHENCIRFIRAWEQYDRLYMQMELCRE-SLEQYLLR---CQRIPEERIWHILLDLLRGLKSLH 216
            .......:..:..|...|.:::|::.|.. .|..:|..   .|.:...|:|.:|..|.:.|..:|
pombe   345 LQACPFVVNLVNVWSYNDNIFLQLDYCENGDLSLFLSELGLLQVMDPFRVWKMLFQLTQALNFIH 409

  Fly   217 DRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGH-FSKAAD 280
            ....:|||:|..||||..|. ..||.||||...:. .:|....|||..|:|||||..| :.|.||
pombe   410 LLEFVHLDVKPSNVLITRDG-NLKLGDFGLATSLP-VSSMVDLEGDRVYIAPEILASHNYGKPAD 472

  Fly   281 IFSLGIAMLELACYMDLPSNGPLWHELRHG-----------ILPEE--FINKI--SLELQSVIKS 330
            ::|||::|:|.|..:.||.||..|..||.|           :|.:|  .|||:  :..||.:::.
pombe   473 VYSLGLSMIEAATNVVLPENGVEWQRLRSGDYSNLPNLKDLLLSKEKVQINKVRCAESLQCLLQR 537

  Fly   331 MMKPDPAQRPTAEQLLSHPKLQYLQK 356
            |..|....|||.:.||:.|::.::.:
pombe   538 MTHPYVDCRPTTQDLLAMPEMIFISE 563

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 84/284 (30%)
Pkinase 102..349 CDD:278497 84/272 (31%)
mik1NP_595093.1 PTKc_Wee1_fungi 288..556 CDD:270954 84/273 (31%)
S_TKc 300..556 CDD:214567 82/261 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1519
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 1 1.000 T631637
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11042
Phylome 1 0.910 0.957 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 00.000 Not matched by this tool.
66.090

Return to query results.
Submit another query.