DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and wee1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_587933.1 Gene:wee1 PomBaseID:SPCC18B5.03 Length:877 Species:Schizosaccharomyces pombe

Alignment Length:394 Identity:131/395 (33%)
Similarity:198/395 (50%) Gaps:59/395 (15%)


  Fly     5 HRLPLPELHDDKHRHKQCNGENSNRFRPPKYKTRGYVAVDNN---NLNRSQSLGSCSTNSSQIAH 66
            |...||.|              ||: |.|...||...|.:|.   :::..|.....|.|::|::.
pombe   477 HNYGLPFL--------------SNQ-RCPATPTRNPFAFENTVSIHMDGRQPSPIKSRNNNQMSF 526

  Fly    67 AISFRDAGCSDSS------TLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDG 125
            |:. .:|..|..|      :.||:...:::|: |.||....|..:..||.|.|.|||||.|..:.
pombe   527 AME-EEADVSQPSSSSFTLSFPSALTSSKVSS-STSHLLTRFRNVTLLGSGEFSEVFQVEDPVEK 589

  Fly   126 QL-YAVKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCRE-SLEQ 188
            .| ||||..|..|.|.:.|...|:||.......||::.:..:.:||....||||:|||.. ||::
pombe   590 TLKYAVKKLKVKFSGPKERNRLLQEVSIQRALKGHDHIVELMDSWEHGGFLYMQVELCENGSLDR 654

  Fly   189 YLL---RCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGL--VI 248
            :|.   :..|:.|.|:|.||:::..||:.:|.:|.:|||:|..||:| ..:.|.|:.|||:  |.
pombe   655 FLEEQGQLSRLDEFRVWKILVEVALGLQFIHHKNYVHLDLKPANVMI-TFEGTLKIGDFGMASVW 718

  Fly   249 DVDRANSHHATEGDSRYMAPEILQGH-FSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGIL 312
            .|.|....   |||..|:|||:|..| :.|.||||||||.:.|.|..:.||.||..|.:||.|.|
pombe   719 PVPRGMER---EGDCEYIAPEVLANHLYDKPADIFSLGITVFEAAANIVLPDNGQSWQKLRSGDL 780

  Fly   313 PE----------EFINKISLE-----------LQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQK 356
            .:          ..:...|.|           |..|::.|:.|:|..|||.:|:|:..::.:::.
pombe   781 SDAPRLSSTDNGSSLTSSSRETPANSIIGQGGLDRVVEWMLSPEPRNRPTIDQILATDEVCWVEM 845

  Fly   357 KRKS 360
            :||:
pombe   846 RRKA 849

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 103/278 (37%)
Pkinase 102..349 CDD:278497 103/276 (37%)
wee1NP_587933.1 PTKc_Wee1_fungi 565..838 CDD:270954 103/277 (37%)
Pkinase 566..836 CDD:278497 103/274 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 114 1.000 Inparanoid score I1519
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 1 1.000 T631637
orthoMCL 1 0.900 OOG5_131219
Panther 1 1.100 LDO PTHR11042
Phylome 1 0.910 0.952 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 00.000 Not matched by this tool.
76.990

Return to query results.
Submit another query.