DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and Wee1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_033542.2 Gene:Wee1 MGIID:103075 Length:646 Species:Mus musculus

Alignment Length:335 Identity:101/336 (30%)
Similarity:161/336 (48%) Gaps:34/336 (10%)


  Fly    69 SFRDAGCSD----SSTLPSSPVQAELSTLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYA 129
            |..|...||    ..|.|:..:....|.:. |.:...|..|.|:|.|.||.||:...|.||.:||
Mouse   262 SSEDMEASDYEFEDETRPAKRITITESNMK-SRYTTEFHELEKIGSGEFGSVFKCVKRLDGCIYA 325

  Fly   130 VKISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCR-----ESLEQY 189
            :|.||:...|.......|.||..:.....|.:.:|:..||.:.|.:.:|.|.|.     :::.:.
Mouse   326 IKRSKKPLAGSVDEQNALREVYAHAVLGQHPHVVRYFSAWAEDDHMLIQNEYCNGGSLADAISEN 390

  Fly   190 LLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLI------------GEDDE----- 237
            ......:.|..:..:||.:.|||:.:|..:|:|:|||..|:.|            |::|:     
Mouse   391 YRVMSYLTEVELKDLLLQVGRGLRYIHSMSLVHMDIKPSNIFISRTSIPNAVSEEGDEDDWISNK 455

  Fly   238 -TCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGHFS--KAADIFSLGIAMLELACYMDLPS 299
             ..|:.|.|   .|.|.:|....|||||::|.|:||.::|  ..||||:|.:.::..|....||.
Mouse   456 VMFKIGDLG---HVTRISSPQVEEGDSRFLANEVLQENYSHLPKADIFALALTVVCAAGAEPLPR 517

  Fly   300 NGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQYLQKKRKSLMNF 364
            ||..|||:|.|.|| .....:|.|:..:::.|:.|||.:||:|.:|:.|..|....:|....:..
Mouse   518 NGEQWHEIRQGRLP-RIPQVLSQEVTELLRVMIHPDPERRPSAMELVKHSVLLSASRKSAEQLRI 581

  Fly   365 SMLSRSFRRS 374
            .:.:..|:.|
Mouse   582 ELNAEKFKNS 591

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 89/274 (32%)
Pkinase 102..349 CDD:278497 89/272 (33%)
Wee1NP_033542.2 PTKc_Wee1a 292..567 CDD:271040 90/279 (32%)
Pkinase 298..568 CDD:278497 89/274 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.