DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and wee-1.3

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_496095.1 Gene:wee-1.3 WormBaseID:WBGene00006940 Length:677 Species:Caenorhabditis elegans

Alignment Length:448 Identity:155/449 (35%)
Similarity:229/449 (51%) Gaps:47/449 (10%)


  Fly    82 PSSPVQAEL----STLSLSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQY 142
            |..|...|.    .|.:.|.|||.|:....:|.|||||||..|.|.|.||||||:|....|  |:
 Worm    84 PQGPKPLESPKYDHTNAQSFFEQVFQIDEIIGRGSFGEVFAARCREDSQLYAVKVSLAPIR--QH 146

  Fly   143 RAERLEEVRRYEEFSGHENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQRIPEERIWHILLD 207
            ...:..|...:.....|:|.::|.||||:..|||:|.|||.:||.:|......:||:.||:|.:|
 Worm   147 SISKYREAESHMIIPPHKNLVKFYRAWEETGRLYIQTELCDQSLLKYCTEKHALPEDEIWNIFVD 211

  Fly   208 LLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANS-HHATEGDSRYMAPEIL 271
            ||:.:..||..::||.|||.:|:.:.: |..|||.||||||::...|. ..|.||||:|:|||:|
 Worm   212 LLQAVHHLHSNDMIHDDIKPENIFLTK-DMICKLGDFGLVINLKNPNDVKSAEEGDSKYLAPEVL 275

  Fly   272 QGHFSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDP 336
            .|..:|::||||||:.:||....:|:||||..||::|:|.:|:.|...||.:|:|:|..|:..||
 Worm   276 NGRPTKSSDIFSLGMTILEATTDLDVPSNGDSWHQIRNGQIPDRFFAGISTDLRSLIALMLDSDP 340

  Fly   337 AQRPTAEQLLSHPKLQYLQKKRKSLMNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLEVLH 401
            ..|||:..||.||.::....||.:.:....:...|..:..||    ..|..|.|..|.:.:...|
 Worm   341 RIRPTSRDLLDHPVIKKKLMKRGTYVKCISILNGFFYAFSAV----LVWVMAFFSVLFHPIVRFH 401

  Fly   402 ---------LCKPITASQPNINIVPSSPSSKGVPLVPQVEFQLVGSTPIANRDCYASDFLSGEDP 457
                     :|.....:|.:..|  .:|.:..|        .|...|.:|.|.  ||..:|   |
 Worm   402 AAIKDRQSEICAQFVNNQQHTPI--QTPETSKV--------YLESLTGVAVRQ--ASQIVS---P 451

  Fly   458 LDLS-NQGSPNVINSTPLNTNQGKSRLDLLKNNVDSMGRYVHVHDFESPCSALSSAKV 514
            .|.| ::..||.  ...|.|.....||:...:..|.        :.::.||:.:|:.:
 Worm   452 FDFSDDENPPNA--QRRLFTGAVPCRLNFDNDQDDD--------EEQATCSSSNSSAI 499

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 112/250 (45%)
Pkinase 102..349 CDD:278497 111/248 (45%)
wee-1.3NP_496095.1 PKc_Myt1 106..353 CDD:270952 112/250 (45%)
S_TKc 108..355 CDD:214567 112/250 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C199876723
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 1 1.000 T374976
orthoMCL 1 0.900 OOG5_131219
Panther 1 1.100 LDO PTHR11042
Phylome 1 0.910 0.667 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R1671
TreeFam 00.000 Not matched by this tool.
98.780

Return to query results.
Submit another query.