DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and zyg-1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_495103.1 Gene:zyg-1 WormBaseID:WBGene00006988 Length:706 Species:Caenorhabditis elegans

Alignment Length:459 Identity:98/460 (21%)
Similarity:187/460 (41%) Gaps:98/460 (21%)


  Fly   102 FERLAKLGEGSFGEVFQVRDRSDGQLYAVK-ISKQLFRGEQYRAERLEEVRRYEEFSGHENCIRF 165
            :..|.::|:|.||.|:..: |.:|:..|:| |.|::.:...:     .|::..:|....:..:.|
 Worm    13 YSHLKEIGKGGFGVVYAAQ-RENGEKVAIKRIDKKVPKNRVW-----TEIQTMKELKKSKYVVEF 71

  Fly   166 IRAWEQYDRLYMQMELCR-ESLEQYLLRCQRIPEERIWHILLDLLRGLKSLHDRNLIHLDIKLDN 229
            ...:.:....|:.||||. .||:.|:.....:.:....|:|..|:..:..:|..|:||.|:...|
 Worm    72 YEDFVEDGYTYIVMELCEGGSLQAYVREHGALDDATAVHVLRQLISAVSFMHRVNVIHRDLSAGN 136

  Fly   230 VLIGEDDE---TCKLADFGLVIDVDRANSHHATEGDSRYMAPEILQGHFSKAADIFSLGIAMLEL 291
            |.|.:..:   |.||.||||...:.|..:.....|...::||::....::::||::|||..:..:
 Worm   137 VFIKDSKKKKMTVKLGDFGLATTLGRGETTCTIVGTPGFIAPQVYDQEYTQSADVYSLGAVLYTM 201

  Fly   292 ACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQR-PTAEQLLSHPKLQYLQ 355
            ....:.|..|          ||...  .:|.....:::.||..|..:| |..:.:||  :..|..
 Worm   202 LTARNPPPKG----------LPPTC--GMSPNAARLVEQMMDTDAKKRIPLTQIVLS--EFMYEN 252

  Fly   356 KKRKSLMNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLEVLHLCKPITASQPNIN-----I 415
            ....:::.....||..||.|..                          :|:.:|:.:.:     :
 Worm   253 TNENAVIFSREHSRDGRRQRSR--------------------------EPVRSSRDDRSRDGRAL 291

  Fly   416 VPSS--PSSKGVPLVPQVEFQLVGSTPIANR---DCYASDFLSGEDPLDLSNQGSPNVINS---- 471
            :.||  |:..             |..|::||   |...|....|.|    |.:|.....:|    
 Worm   292 IRSSSQPAHS-------------GRAPLSNRPIHDRMPSTSSRGFD----SERGRERDRDSGRGT 339

  Fly   472 -TPLNTNQGKS-----RLDLLKNN--VDSMGRYVHVHDFESPCSALSSAKVLDTSSFRRKKLFVL 528
             .|...::.:|     |:|.|:..  ..:.|||  :.:.::.|    ..:|....:| .|::.::
 Worm   340 VPPSREDRNRSQLWPIRMDRLEGQRVCTAGGRY--IVELDTRC----RFEVAAQGNF-VKRILIV 397

  Fly   529 EYDD 532
            |.|:
 Worm   398 EVDE 401

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 62/253 (25%)
Pkinase 102..349 CDD:278497 62/253 (25%)
zyg-1NP_495103.1 S_TKc 13..249 CDD:214567 62/256 (24%)
PKc_like 13..238 CDD:304357 59/243 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR11042
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.