DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and CSF3

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:NP_000750.1 Gene:CSF3 HGNCID:2438 Length:207 Species:Homo sapiens

Alignment Length:113 Identity:28/114 (25%)
Similarity:44/114 (39%) Gaps:24/114 (21%)


  Fly    54 LGSCSTNSSQIAHAIS------FRDAGCSDSSTLPSSPVQAELSTLSLSHFE---QCFERLAKLG 109
            |.||.:.:.|:|..:|      |...|...:....|..:...|.||.|...:   ..::::.:||
Human    94 LSSCPSQALQLAGCLSQLHSGLFLYQGLLQALEGISPELGPTLDTLQLDVADFATTIWQQMEELG 158

  Fly   110 --------EG---SFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAER 146
                    :|   :|...||  .|:.|.|.|..:  |.|....||..|
Human   159 MAPALQPTQGAMPAFASAFQ--RRAGGVLVASHL--QSFLEVSYRVLR 202

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 15/59 (25%)
Pkinase 102..349 CDD:278497 15/57 (26%)
CSF3NP_000750.1 GCSF 51..202 CDD:293253 27/112 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.