DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and LOC108648112

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_017951221.1 Gene:LOC108648112 ID: Length:364 Species:Xenopus tropicalis

Alignment Length:325 Identity:99/326 (30%)
Similarity:147/326 (45%) Gaps:89/326 (27%)


  Fly    97 HFEQCF---ERLAKL----GEGSFGEV----FQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEV 150
            ||::.:   ||:.||    |||.||.|    .|:::|.    .|:||.|.|...|..|    .|:
 Frog    15 HFQEKYPEPERILKLGKAIGEGGFGVVHKGWHQIKNRQ----VAIKIIKDLENEEIIR----NEL 71

  Fly   151 RRYEEFSGHENCIRFIRAW--------EQYDRLYMQMELC--------RESLEQYLLRCQRIPEE 199
            ...|:.|||||.|.|..|:        .|.:.|::.||.|        .|:.:.|.|     .|.
 Frog    72 EILEKVSGHENIITFHGAFYQKPNVRNSQNEGLWIAMEFCAGGSIYDLMETKKDYSL-----GER 131

  Fly   200 RIWHILLDLLRGLKSLHDRNLIHLDIKLDNVLIGEDDETCKLADFGLVIDVDRANSHHATEGDSR 264
            .|.:|...:|:||..|.|..:||.|:|.:|:::....: .|:.||||....:.:.|   ..|.:.
 Frog   132 WISYICKGVLQGLCHLQDLKMIHHDLKPENLMLTRSAD-IKIIDFGLATVGETSIS---VAGTAT 192

  Fly   265 YMAPEIL------QGHFSKAADIFSLGIAMLELACYMDLPSNGPLWHELRHGILPE-EFINKI-- 320
            |||||:.      ...:...||::||||..:|:|     ..|.|      |..|.| :||.::  
 Frog   193 YMAPEVFACCQDNYVEYDNKADVWSLGIIAIEMA-----EGNAP------HSELTEIKFIKRVIH 246

  Fly   321 -----------SLELQSVIKSMMKPDPAQRPTAEQLLSHP-----------KLQ---YLQKKRKS 360
                       |:.....|...:|.|||:||||:|||||.           |:|   :|||.:::
 Frog   247 GPPPKLTWTRWSVTFHDFIYQCLKKDPAKRPTAKQLLSHQFIAGMWDERDVKIQISKHLQKCKEA 311

  Fly   361  360
             Frog   312  311

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 92/296 (31%)
Pkinase 102..349 CDD:278497 92/294 (31%)
LOC108648112XP_017951221.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.