DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Myt1 and pkmyt1

Sequence 1:NP_647987.2 Gene:Myt1 FlyBaseID:FBgn0040298 Length:533 Species:Drosophila melanogaster
Sequence 2:XP_012825559.1 Gene:pkmyt1 XenbaseID:XB-GENE-969853 Length:603 Species:Xenopus tropicalis

Alignment Length:558 Identity:185/559 (33%)
Similarity:281/559 (50%) Gaps:114/559 (20%)


  Fly    32 PPKYKTRGYVAVDNNNLNRSQSLGSCSTNSSQIAHAISFRDAGCSDSSTLPSSPV--QAELSTLS 94
            ||:...:..:.:.....|:.:|.      |.....::|||    |..:..|:|.:  |::..|. 
 Frog    99 PPRPPVKSALPISRLFPNKQRSW------SQPRPQSVSFR----SPQNNPPASELYDQSKGETF- 152

  Fly    95 LSHFEQCFERLAKLGEGSFGEVFQVRDRSDGQLYAVKISKQLFRGEQYRAERLEEVRRYEEFSGH 159
               |:|||..:.|||.||||||::|:...||..||||.|...||||..|..:|:|||::|....|
 Frog   153 ---FKQCFRSICKLGRGSFGEVYKVQSLEDGCFYAVKRSVSPFRGESDRQRKLQEVRKHERVGVH 214

  Fly   160 ENCIRFIRAWEQYDRLYMQMELCRESLEQYLLRCQ-RIPEERIWHILLDLLRGLKSLHDRNLIHL 223
            .||:||:||||:...||:|.|||..||:|:..... .:|..:||:|..|||.|||.||||||:||
 Frog   215 PNCLRFVRAWEEKRLLYLQTELCAGSLQQHSEEFSGPLPPRKIWNITCDLLHGLKHLHDRNLLHL 279

  Fly   224 DIKLDNVLIGEDDETCKLADFGLVIDVD-RANSHHATEGDSRYMAPEILQGHFSKAADIFSLGIA 287
            |||..||.|.... .|||.||||::::| ...|..|.|||.||||||:|.|.||||||:||||::
 Frog   280 DIKPANVFISFSG-VCKLGDFGLMVELDGTEGSGEAQEGDPRYMAPELLDGIFSKAADVFSLGMS 343

  Fly   288 MLELACYMDLPSNGPLWHELRHGILPEEFINKISLELQSVIKSMMKPDPAQRPTAEQLLSHPKLQ 352
            :||:||.|:||.:|..|.:||.|.||.||.:.:..:...|:.:|::||..:|.|.:.|||.|.::
 Frog   344 LLEVACNMELPKSGDGWQQLRQGRLPTEFTSDLPPDFLKVLAAMLEPDYRRRATVDWLLSLPAIR 408

  Fly   353 YLQKKRKSLMNFSMLSRSFRRSRRAVWGRMCNWKTAAFRYLLYFLEV------------LHLCKP 405
            ..::.|       |::.:..|:...:        ...::::::.:.:            ||.|  
 Frog   409 NAERWR-------MVTLAQERTLGKI--------ITVYQFIVWLVSIVFQGLNRPVVGFLHYC-- 456

  Fly   406 ITASQPNINIVPSSPSSKGVPLVPQVEFQLVGSTPIANRDCYASDF---LSGED-------PL-- 458
                  .:..:|.||     |..|         :|......::||:   ..|:|       ||  
 Frog   457 ------GLRALPRSP-----PCSP---------SPNLGESSFSSDWDDESLGDDVFEVPPSPLAA 501

  Fly   459 ---------DLSNQGSPNVIN-------STPLNTN-----QGKSRLDLLKN----NVDSMGRYVH 498
                     :|..:.||::::       |||.|.:     :.:|.|.|..|    :.:|.|....
 Frog   502 HRNFTYHGQELIGRHSPDLLSRPSLGSTSTPRNLSPEFSMRKRSALPLTPNVSRISQESSGSVKS 566

  Fly   499 VHDFESPCSALSSAKVLDT----SSFRRKKLFVLEYDD 532
            .    ||.::.||:..:|.    |||..:.|..: :||
 Frog   567 T----SPSTSHSSSGFVDAEVQRSSFLPRNLLSM-FDD 599

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Myt1NP_647987.2 PKc_Myt1 100..349 CDD:270952 128/251 (51%)
Pkinase 102..349 CDD:278497 126/249 (51%)
pkmyt1XP_012825559.1 PKc_Myt1 155..405 CDD:270952 128/251 (51%)
Pkinase 162..405 CDD:278497 125/244 (51%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C200302239
eggNOG 1 0.900 E1_KOG0601
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D1063695at2759
OrthoFinder 1 1.000 FOG0002119
OrthoInspector 00.000 Not matched by this tool.
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 1 0.960
65.710

Return to query results.
Submit another query.