DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: scny and Usp17la

Sequence 1:NP_729092.1 Gene:scny FlyBaseID:FBgn0260936 Length:1038 Species:Drosophila melanogaster
Sequence 2:NP_031913.1 Gene:Usp17la MGIID:107699 Length:526 Species:Mus musculus

Alignment Length:583 Identity:156/584 (27%)
Similarity:243/584 (42%) Gaps:132/584 (23%)


  Fly   155 ENIRIGWKQSERKWQ----VGTGMINVGNTCYLNSTLQALLHIPALANWLVSEQAHLADCNVAEP 215
            |.:.:..|.| ..|:    .|.|:.|.||:||||:.||.|.|.|.||::::| |.|...|...| 
Mouse    31 EELTVNGKHS-LSWESPQGPGCGLQNTGNSCYLNAALQCLTHTPPLADYMLS-QEHSQTCCSPE- 92

  Fly   216 GSGCIICAMTKTLLATQSNQSAVRPFLIYSKLKQICK--HMVVG-----RQEDAHEFLRFLVEAM 273
              ||.:|||  ..|.|||        |::|....:.|  |::..     :||||||||.|.:|.|
Mouse    93 --GCKLCAM--EALVTQS--------LLHSHSGDVMKPSHILTSAFHKHQQEDAHEFLMFTLETM 145

  Fly   274 ERAYLMRFRNYKELDQLVKETTPLGQIFGGYLRSEVRCLSCNHVSITFQHFQDLLLDIRKADSLE 338
            ..:.|...|..|...:   :::|:..||||:.||:::||.|...|.|:..|.|:.|||..|.|::
Mouse   146 HESCLQVHRQSKPTSE---DSSPIHDIFGGWWRSQIKCLLCQGTSDTYDRFLDIPLDISSAQSVK 207

  Fly   339 DA-FEGHFSRERLEDMGYKCEGCKKKVSATKQFSLERAPITLCIQLKRFS-MIGNKLTKQISFKS 401
            .| ::...|.|...|..|.|..|::|:.|:|...:..||..|.:.|.||| ..||||.:::|:..
Mouse   208 QALWDTEKSEELCGDNAYYCGKCRQKMPASKTLHVHIAPKVLMVVLNRFSAFTGNKLDRKVSYPE 272

  Fly   402 RIDLSKYAARSQAAQAQPLTYRLVSMVTHLGASQHCGHYTAIGSTDTGSFYNFDDSYVRPIAMHS 466
            .:||..|.:.....   ||.|.|.:::.|.||:.|.|||........|.:|..||:.|....:.|
Mouse   273 FLDLKPYLSEPTGG---PLPYALYAVLVHDGATSHSGHYFCCVKAGHGKWYKMDDTKVTRCDVTS 334

  Fly   467 VCNTNAYIMFF--ELDLSQAASPAANRPNGVRLTNGHSTTPVPAATVSSPSPTRFIGPQLPAGGA 529
            |.|.|||::|:  :.:|.|                                    :...:|.|..
Mouse   335 VLNENAYVLFYVQQANLKQ------------------------------------VSIDMPEGRI 363

  Fly   530 NGYTNGNAQKTAIQFKQQNQQSP---------QN-------GLQLGTGKFQDTAKPPLVGAHAKG 578
            |...:...|....:.|:..::||         :|       ...||.||......      |.| 
Mouse   364 NEVLDPEYQLKKSRRKKHKKKSPFTEDLGEPCENRDKRAIKETSLGKGKVLQEVN------HKK- 421

  Fly   579 EATSAPTANGNKSSSPSSNSSSNHKSINQQQYLPISSDDEDIEDEMKPRPTTAQLPSMPNMTEN- 642
                |...:||....|   ...||:...|      :..:.::|.::   |..|.:...|..|.| 
Mouse   422 ----AGQKHGNTKLMP---QKQNHQKAGQ------NLRNTEVELDL---PADAIVIHQPRSTANW 470

  Fly   643 -------HTEPKAKSPVKIQVKTPVKTPLKSLVPYESASEEEEAPLPNPRKRPSGEDSSESDQ 698
                   ..:|...:...:..:.||.|       ::...:|      ..|:...|::.::..|
Mouse   471 GRDSPDKENQPLHNADRLLTSQGPVNT-------WQLCRQE------GRRRSKKGQNKNKQGQ 520

Known Domains:


GeneSequenceDomainRegion External IDIdentity
scnyNP_729092.1 Peptidase_C19E 171..477 CDD:239126 115/315 (37%)
UCH 172..477 CDD:278850 114/314 (36%)
Asp-B-Hydro_N <617..>731 CDD:191249 14/91 (15%)
Usp17laNP_031913.1 Peptidase_C19E 50..346 CDD:239126 115/316 (36%)
UCH 51..345 CDD:278850 114/314 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG1865
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000144
OrthoInspector 1 1.000 T616834
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 O PTHR24006
Phylome 1 0.910 0.941 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.910

Return to query results.
Submit another query.