DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sse and ESP1

Sequence 1:NP_523935.1 Gene:Sse FlyBaseID:FBgn0035627 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_011612.3 Gene:ESP1 SGDID:S000003330 Length:1630 Species:Saccharomyces cerevisiae

Alignment Length:648 Identity:131/649 (20%)
Similarity:237/649 (37%) Gaps:165/649 (25%)


  Fly     9 EMLAGFTSS-DVGPEAKEYNLLRADEEYRNG-----------------NVEHSIYYQVKAQFQST 55
            |...|..|| .|.|.....|:|:...::..|                 |:... :.::.|..:..
Yeast   991 ESTLGIPSSLPVIPSTMPNNILKTPSKHSTGLKLCDSPRSSSMTPRGKNIRQK-FDRIAAISKLK 1054

  Fly    56 DLRYLTESAELENQRPTAEELIKSATKLEKKDYKSKKFLQNIIKYLQQMEQEKQPKKPINEIPEY 120
            .::.|.||.:|:.........|.|.:.|      :...|.||.. :...|........:.::|.:
Yeast  1055 QMKELLESLKLDTLDNHELSKISSLSSL------TLTILSNITS-IHNAESSLITNFSLTDLPRH 1112

  Fly   121 LDFLDDVQDPTEGLTRISEKCNSLPQEWCVLQLCKSFNPAT-TYSV-----FNEIIASDGAIYLT 179
            :..|.|     :.|..|.   |...:|:.|..|....|.:| |.|:     ..:::.|:..|.:.
Yeast  1113 MPLLFD-----KVLNNID---NKNYREFRVSSLIAPNNISTITESIRVSAAQKDLMESNLNINVI 1169

  Fly   180 LLRHC------RSSQLGP-------ICLKISNENTANL------FREYS----TLVERFRRVVTV 221
            .:..|      ..|:|.|       :.|.:...|:.:|      |.|.:    :::....:..:|
Yeast  1170 TIDFCPITGNLLLSKLEPRRKRRTHLRLPLIRSNSRDLDEVHLSFPEATKKLLSIINESNQTTSV 1234

  Fly   222 DPLN-MKGKEAKQKYWEELNGFDTFQQKLLADFR-------------DIISPYSF-LFFGKRYDC 271
            :..| :|.:|.::.:|......|...|:||.:..             :::....| .|..|.|: 
Yeast  1235 EVTNKIKTREERKSWWTTRYDLDKRMQQLLNNIENSWFNGVQGFFSPEVVDNSLFEKFKDKFYE- 1298

  Fly   272 TVVQKQI--------KATYTRVDD-----FCLLNQWGTHQRVLLSQAASHANRLEIADLKLICYE 323
             ::.:.:        .|.:.:|:|     |..||          .|.....:::|  ||.....:
Yeast  1299 -ILHQNLPSRKLYGNPAMFIKVEDWVIELFLKLN----------PQEIDFLSKME--DLIYFVLD 1350

  Fly   324 LSSNENEIQSAYELLKGLASDWA----EVEE-----RQPLASRR-FPIILVVDERLDHLHWEQLV 378
            :.....| ::||:.:     |::    ::||     |..:.:.. |...|||........||.|.
Yeast  1351 ILLFHGE-ENAYDEI-----DFSMLHVQLEEQIKKYRATMTTNSIFHTFLVVSSSCHLFPWECLS 1409

  Fly   379 TVQEFS--RVKSLHCLWRLFQNH----------KSNIKHGYYTTNIKRGMCVINPDADLVNSGRR 431
            .:::.|  ||.|..||.:|....          :.||.            .::||:.||..:..:
Yeast  1410 FLKDLSITRVPSYVCLNKLLSRFHYQLPLQVTIEDNIS------------MILNPNGDLSRTESK 1462

  Fly   432 LRSFFEYWLS---QWQHLFETVPNEEVMVKQALQADCFVYAGHGSGLQYVNGRIICRARVRSVVF 493
            .:..|:..:.   ..|.:....|.||.::|....::.|||.|||.|.|||..:.|.:....:..|
Yeast  1463 FKGMFQKIIDAKPSSQLVMNEKPEEETLLKMLQNSNLFVYIGHGGGEQYVRSKEIKKCTKIAPSF 1527

  Fly   494 LFGCDSTRM--------LGTGLYSALYGAHDYYHGALCPSIVGTLMPALDGNMDTVSVTILSR 548
            |.||.|..|        .|| :|:.|.|.        ||.::|.|....|.::|..|..:..:
Yeast  1528 LLGCSSAAMKYYGKLEPTGT-IYTYLLGG--------CPMVLGNLWDVTDKDIDKFSEELFEK 1581

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SseNP_523935.1 Peptidase_C50 171..538 CDD:281555 94/451 (21%)
ESP1NP_011612.3 ESP1 1..1630 CDD:227484 131/649 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C349439961
eggNOG 1 0.900 E1_COG5155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7216
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002751
OrthoInspector 1 1.000 T1136626
orthoMCL 1 0.900 OOG5_129440
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R264
TreeFam 00.000 Not matched by this tool.
76.710

Return to query results.
Submit another query.