DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Sse and ZK430.5

Sequence 1:NP_523935.1 Gene:Sse FlyBaseID:FBgn0035627 Length:634 Species:Drosophila melanogaster
Sequence 2:NP_494778.1 Gene:ZK430.5 WormBaseID:WBGene00022741 Length:1276 Species:Caenorhabditis elegans

Alignment Length:622 Identity:120/623 (19%)
Similarity:221/623 (35%) Gaps:190/623 (30%)


  Fly    62 ESAELENQRPTAEELIKSATKLEKKDYKSKKF-------------------LQNIIKYLQQMEQE 107
            :|...||.|.|.:..::....:..::::.:.:                   ..||.....|.||.
 Worm   650 DSQRFENNRLTMQREMQYFAHILYREWRCRMYSYVGKTSKSSWEAAYGWAESTNIGSRNAQQEQL 714

  Fly   108 KQPKKPINEIPEYLDFLDDVQDPTEGLTRISEKCNSLPQEWCVLQLCKSFNPATTYSVFNEIIAS 172
            .:.|..:..||              |:...:....::|.:..::|:               ::|.
 Worm   715 GKCKSGLVTIP--------------GVHHFNSCGQNMPDDMTLIQI---------------VMAD 750

  Fly   173 DGAIYLTLLRHCRSSQLGPICLKISNENTA-NLFREYSTLVERFRRVVTVDPLNMKGKEAKQKY- 235
            |..|||..|...|.    ||.:.:::.:.| .:..:::.|:|..|::|:        ...|.|: 
 Worm   751 DKTIYLVKLHADRD----PIIMPLAHYHQAIEVMDKFTYLLEEDRQIVS--------NHEKYKFE 803

  Fly   236 --WEELNGFDTFQQKLLADFRDIISPYSFLFFGKRYDCTVVQKQIKATYTRVDDFCLLNQWGTHQ 298
              |               |.|.|:            ||     |:|.        |:.|.    |
 Worm   804 ECW---------------DRRKIV------------DC-----QMKK--------CVENT----Q 824

  Fly   299 RVLLSQAAS----------HANRLEI------------ADLKLICY------------------E 323
            :..|..|||          :|..|.|            .:.|.:.|                  |
 Worm   825 KHFLGAAASLLLPSGRLGPNATALAIKMYNMAKGGLLPGEAKELVYQSKFIHPKTWKSLVLRYCE 889

  Fly   324 LSSNENEIQSAYELLKGLASDWAEVEERQPLASRRFPIILVVDERLDHLHWEQLVTVQEFSRVK- 387
            :...:|:.:|...||:....:..:.::..| ||.:....||:...|....||:|....:|..|. 
 Worm   890 MRGIDNKSKSQLLLLRKDGFNAMKQDQTIP-ASSKIYTHLVICPYLSQFCWERLPIFAKFPYVVR 953

  Fly   388 --SLHCLWRLFQNHKSNIKHGYYTTNIKRGMCVINPDADLVNSGRRLRSFFEYWLSQWQHLFETV 450
              |:|..:....:.::..|.......::....:::||.:|..:.||:..:...:  .|:....:.
 Worm   954 HISIHSAFSQLDDMRNQNKQIPLNIGLENAFYILDPDNNLNGTKRRMLKYINKF--NWEGSVGSA 1016

  Fly   451 PNEEVMVKQALQADCFVYAGHGSGLQYVNGRIICRARVRSVVFLFGCDSTRMLGTGLYSALYGAH 515
            |....:.....:.|.|.|.|||||...|...:|.:....::.||.||:|.|.:..        ||
 Worm  1017 PKLTEVTDALSKRDAFFYFGHGSGSSVVTQSLIRQTTCNAISFLMGCESVRTIPQ--------AH 1073

  Fly   516 DY--------YHGALCPSIVGTLMPALDGNMDTVSVTILSRWLAPGDN--KVIPWTHIDRVPWLK 570
            .:        |..|.|||:||.|.          .|.::::..:.|:|  :.:|.|....:.:.|
 Worm  1074 GFDGTSVIQDYAMAKCPSLVGCLW----------DVQVVAKHTSIGNNGKENLPITTGRMISYSK 1128

  Fly   571 NGIIKGKDETTPTMND---QPNYHLGSLCSILSLVQQ 604
            ...|:   ||.|..::   ..||:  ::.|..||.|:
 Worm  1129 KPKIR---ETEPNSSNLILASNYN--NITSKASLSQE 1160

Known Domains:


GeneSequenceDomainRegion External IDIdentity
SseNP_523935.1 Peptidase_C50 171..538 CDD:281555 88/422 (21%)
ZK430.5NP_494778.1 Peptidase_C50 749..1099 CDD:281555 88/427 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C349067764
eggNOG 1 0.900 E1_COG5155
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 0 Normalized mean entropy S7216
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0002751
OrthoInspector 1 1.000 T374832
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 0.889 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R264
TreeFam 00.000 Not matched by this tool.
76.720

Return to query results.
Submit another query.