DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and Prdm5

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:XP_006506667.1 Gene:Prdm5 MGIID:1918029 Length:630 Species:Mus musculus

Alignment Length:971 Identity:182/972 (19%)
Similarity:303/972 (31%) Gaps:377/972 (39%)


  Fly   122 LPRSLTLKSSMVYSTPNVKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNK---ARYFWRVQGT 183
            :|....||||.|..     ..|::::..:.:|.:||||.|  ....|.|.::   .|..|.|:|:
Mouse     6 VPDRFALKSSRVQD-----GMGLYTARRVRKGEKFGPFAG--EKRMPEDLDENMDYRLMWEVRGS 63

  Fly   184 RHITYGNIKIFKDDDYYYLDGSDRSQSNWMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNE 248
                       |.:..|.||.::...|||:|:|..|.|....||.|.|..|||::....||..:.
Mouse    64 -----------KGEVLYILDATNPRHSNWLRFVHEAPSQERKNLAAIQEGENIFYLAVDDIETDT 117

  Fly   249 ELMVWYCKDFASRLGYDVDPETTIFGACKQAVEAEEEADEEEEEA--EGEDGKPRYSMPAPEIPP 311
            ||::.|                         ::::.||:|||::|  ..::||            
Mouse   118 ELLIGY-------------------------LDSDVEAEEEEQQALTMTKEGK------------ 145

  Fly   312 DVAVSHITYVMGLHLPVGAGNGPANGSV-AGSVSGATPPPPTATPCCRRSSPPAHVSTTTSTCNA 375
               |.|                 :.|.: |||..........|.|.|..|.|...|.|       
Mouse   146 ---VDH-----------------SKGQLAAGSKGHLGCEEDFACPQCESSFPSEEVLT------- 183

  Fly   376 HHPHIQHGRHASVIIGQDRSPMASSDKDTAGSPLSGLDHQMTPQDGSVRSVRSDEGYHSNECHED 440
                 :|                          |..|..:.|             |....:|...
Mouse   184 -----EH--------------------------LQSLHQKPT-------------GEKEFKCENC 204

  Fly   441 GLTPPEDSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPPAVVMANTTTNSMISHSSPTAT 505
            |...|.    .::...:.|.|:.::          :.|.|||.....:.|:..:|.:|.      
Mouse   205 GKKFPV----RQALQRHALFCTARS----------SLKNSSSSVQCALCNSLFSSALSF------ 249

  Fly   506 PICETDKNEYRKFKVKMPLKYEFKNKTCVKQEPSLKEVDQEMSLPQEEEEDQVMHPEPDSICPST 570
                   .::|| ..:...::..|..:|.|:   ||..|   :|.:.:|......|:...||...
Mouse   250 -------EQHRK-ACRGEARFVCKADSCGKR---LKSKD---ALRRHQENVHTGDPKRKLICSVC 300

  Fly   571 TTHLGDEHMLMMERERERERERIQEREPSNQQPASSTVIVLEHNSGGQARTIVPLSKPYYEPDPP 635
                                          .:..:|...:.||..                    
Mouse   301 ------------------------------NRKCTSVSSLQEHRK-------------------- 315

  Fly   636 GERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGNAV 700
                          :..|...|..::...:|....|.              ..::.:.:.|...:
Mouse   316 --------------IHEIFDCQECMKKFISANQLKRH--------------MITHSEKRPYNCEI 352

  Fly   701 SPDSSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPPPSHHHHNVIFSPSRHAAYLGAGEA 765
            ...|...|.|           ||.                      |.||               
Mouse   353 CNKSFKRLDQ-----------VGA----------------------HKVI--------------- 369

  Fly   766 GGHSPSPGY------PGYPHYGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTSTQM 824
              ||....|      .|:.|......   |...||...||  |.:|...        |.:|...:
Mouse   370 --HSEDKPYQCKLCGKGFAHRNVYKN---HKKTHSEERPF--QCDACKA--------LFRTPFSL 419

  Fly   825 LNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLKKKDGKMH 889
            ..|.|:.                                                     :.:..
Mouse   420 QRHLLIH-----------------------------------------------------NSERT 431

  Fly   890 YECNVCCKTFGQLSNLKVHLR-THSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKK 953
            ::|:.|..||.:...|.||:: .|...:.::|.:|.|:|...:.|:.|...|||||...|..|.:
Mouse   432 FKCHHCDATFKRKDTLNVHVQVVHERHKKYRCELCNKAFVTPSVLRSHKKTHTGEKEKVCPYCGQ 496

  Fly   954 RFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLR 1018
            :|:|:..|:.|:|.|:|::||.|..|.:.|::...||:|.|.||.::||.|..|.|.:....||.
Mouse   497 KFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMHIRTHTREKPYQCSECSKAFSQKRGLD 561

  Fly  1019 THWKT-TSCKPNNLEEELAMAAAATSECL-------DKDHPEPDSREAYEQLTQHMHPAVH 1071
            .|.:| |..||  .:.::...|.:..:.|       :.:.|..:....:::.|::.:..||
Mouse   562 EHKRTHTGEKP--FQCDVCDLAFSLKKMLIRHKMTHNPNRPMAECHFCHKKFTRNDYLKVH 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614 37/130 (28%)
C2H2 Zn finger 892..912 CDD:275368 7/21 (33%)
zf-H2C2_2 904..929 CDD:290200 8/26 (31%)
C2H2 Zn finger 920..940 CDD:275368 6/20 (30%)
zf-H2C2_2 932..957 CDD:290200 10/25 (40%)
C2H2 Zn finger 948..968 CDD:275368 7/20 (35%)
zf-H2C2_2 960..985 CDD:290200 10/25 (40%)
C2H2 Zn finger 976..996 CDD:275368 7/20 (35%)
C2H2 Zn finger 1004..1023 CDD:275368 6/19 (32%)
Prdm5XP_006506667.1 SET 20..123 CDD:214614 35/116 (30%)
COG5048 167..620 CDD:227381 125/734 (17%)
C2H2 Zn finger 169..190 CDD:275368 9/59 (15%)
C2H2 Zn finger 201..217 CDD:275368 3/20 (15%)
C2H2 Zn finger 236..256 CDD:275368 5/34 (15%)
C2H2 Zn finger 264..287 CDD:275368 8/29 (28%)
C2H2 Zn finger 297..317 CDD:275368 4/84 (5%)
C2H2 Zn finger 322..342 CDD:275368 3/34 (9%)
zf-H2C2_2 335..359 CDD:290200 3/38 (8%)
C2H2 Zn finger 350..370 CDD:275368 8/70 (11%)
C2H2 Zn finger 378..398 CDD:275368 3/23 (13%)
C2H2 Zn finger 406..426 CDD:275368 5/28 (18%)
C2H2 Zn finger 434..455 CDD:275368 7/21 (33%)
C2H2 Zn finger 463..483 CDD:275368 6/20 (30%)
C2H2 Zn finger 491..511 CDD:275368 7/20 (35%)
zf-H2C2_2 504..527 CDD:290200 10/23 (43%)
C2H2 Zn finger 519..539 CDD:275368 7/20 (35%)
zf-H2C2_2 532..556 CDD:290200 11/24 (46%)
C2H2 Zn finger 547..567 CDD:275368 7/20 (35%)
zf-H2C2_2 560..583 CDD:290200 7/25 (28%)
C2H2 Zn finger 575..595 CDD:275368 2/20 (10%)
C2H2 Zn finger 604..625 CDD:275368 3/18 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.