DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and Prdm5

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:XP_017458299.1 Gene:Prdm5 RGDID:1588700 Length:630 Species:Rattus norvegicus

Alignment Length:930 Identity:191/931 (21%)
Similarity:292/931 (31%) Gaps:346/931 (37%)


  Fly   122 LPRSLTLKSSMVYSTPNVKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNK---ARYFWRVQGT 183
            :|....||||.|..     ..|::::..:.:|.:||||.|  ....|.|.::   .|..|.|:|:
  Rat     6 VPDRFALKSSRVQD-----GMGLYTARRVRKGEKFGPFAG--EKRMPEDLDENMDYRLMWEVRGS 63

  Fly   184 RHITYGNIKIFKDDDYYYLDGSDRSQSNWMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNE 248
                       |.:..|.||.::...|||:|:|..|.|....||.|.|..|||::....||..:.
  Rat    64 -----------KGEVLYILDATNPRHSNWLRFVHEAPSQERKNLAAIQEGENIFYLAVDDIETDT 117

  Fly   249 ELMVWYCKDFASRLGYDVDPETTIFGACKQAVEAEEEADEEEEEA--EGEDGKPRYSMPAPEIPP 311
            ||::.|                         ::::.||:|||::|  ...:||            
  Rat   118 ELLIGY-------------------------LDSDVEAEEEEQQALTMAREGK------------ 145

  Fly   312 DVAVSHITYVMGLHLPVGAGNGPANGSV-AGSVSGATPPPPTATPCCRRSSPPAHVSTTTSTCNA 375
               |.|                 :.|.: |||..........|.|.|..|.|...|.|       
  Rat   146 ---VDH-----------------SKGQLAAGSKGHLGCEEDFACPQCESSFPSEEVLT------- 183

  Fly   376 HHPHIQHGRHASVIIGQDRSPMASSDKDTAGSPLSGLDHQMTPQDGSVRSVRSDEGYHSNECHED 440
                 :|                          |..|..:.|             |....:|...
  Rat   184 -----EH--------------------------LQSLHQKPT-------------GEKEFKCENC 204

  Fly   441 GLTPPEDSSDSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPPAV--VMANTTTNSMISHSSPT 503
            |...|.    .::...:||.|:.::            ....|||.|  .:.|:..:|.:|.|...
  Rat   205 GKKFPV----RQALQRHVLSCAARS------------NLQDSPPRVQCSLCNSLFSSALSFSQHQ 253

  Fly   504 ATPICETDKNEYRKFKVKMPLKYEFKNKTCVKQEPSLKEVDQEMSLPQEEEEDQVMHPEPD---S 565
            ..  |..|            .::..|..:|.|:   ||..|   :|.:..|......|:..   |
  Rat   254 KA--CRGD------------ARFVCKVDSCGKR---LKSKD---ALKRHRENVHTGDPKRKLICS 298

  Fly   566 ICPSTTTHLG--DEHMLMME--------------RERERERERIQEREPSNQQPASSTVIVLEHN 614
            :|....|.|.  .||..:.|              .:.:|......|:.|.|.:..:.:...|:  
  Rat   299 VCNRRCTSLSSLQEHRKIHEIFDCQECMKKFISANQLKRHMITHSEKRPYNCEICNKSFKRLD-- 361

  Fly   615 SGGQARTIVPLSKPYYEPDPPGERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPP 679
            ..|..:.|....|||                                       .|:...     
  Rat   362 QVGAHKVIHSEDKPY---------------------------------------QCKLCG----- 382

  Fly   680 PTSPTEMAYSYKKSQRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSP---PP 741
                        |...:.|.......::..:.|.|..                   ||..   .|
  Rat   383 ------------KGFAHRNVYKNHKKTHSEERPFQCD-------------------ECKALFRTP 416

  Fly   742 PSHHHHNVIFSPSRHAAYLGAGEAGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQSNAS 806
            .|...|.:|.:..|                               ||..  |...:.|.|:    
  Rat   417 FSLQRHLLIHNSER-------------------------------TFKC--HHCDATFKRK---- 444

  Fly   807 SGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCPRSGSPLSPNSLAS 871
                ...|:|:     |:::          :|....|.          ..|  |.:.::|:.|.|
  Rat   445 ----DTLNVHV-----QVVH----------ERHKKYRC----------ELC--SKAFVTPSVLRS 478

  Fly   872 RGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKH 936
            .        .|...|:....|..|.:.|.....|:||:|:|:||||::|..|.|.|::...|:.|
  Rat   479 H--------KKTHTGEKEKVCPYCGQKFASSGTLRVHIRSHTGERPYQCPYCEKGFSKNDGLKMH 535

  Fly   937 HLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRP 1001
            ...||.|||:||..|.|.||....|..|.|.|:|:||:.||:|...|:....|..||..|..:||
  Rat   536 IRTHTREKPYQCSECSKAFSQKRGLDEHKRTHTGEKPFQCDVCDLAFSLKKMLIRHKMTHNPNRP 600

  Fly  1002 YV-CQGCDKKYISASGLRTH 1020
            .. |..|.||:.....|:.|
  Rat   601 MAECHFCHKKFTRNDYLKVH 620

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614 37/130 (28%)
C2H2 Zn finger 892..912 CDD:275368 7/20 (35%)
zf-H2C2_2 904..929 CDD:290200 13/25 (52%)
C2H2 Zn finger 920..940 CDD:275368 6/20 (30%)
zf-H2C2_2 932..957 CDD:290200 13/25 (52%)
C2H2 Zn finger 948..968 CDD:275368 8/20 (40%)
zf-H2C2_2 960..985 CDD:290200 11/25 (44%)
C2H2 Zn finger 976..996 CDD:275368 7/20 (35%)
C2H2 Zn finger 1004..1023 CDD:275368 6/18 (33%)
Prdm5XP_017458299.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.