DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and PRDM8

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:XP_011530435.1 Gene:PRDM8 HGNCID:13993 Length:970 Species:Homo sapiens

Alignment Length:1047 Identity:210/1048 (20%)
Similarity:297/1048 (28%) Gaps:425/1048 (41%)


  Fly    33 PHHPAHSHPLNHPHP-HQHAQPHP---HPHPHPH-HKLS-------ARRARSRSRSRSPTPDGNQ 85
            |..|...|||.| || ...:.|.|   .|....| |.|:       .:|..|.:.||        
Human   209 PRRPRQLHPLLH-HPLDVKSFPEPILEEPKRRQHQHLLTWKYTDTIGKRKHSIASSR-------- 264

  Fly    86 DYDVTRMREEDFERLAVYLVP---DVQAERGLPNRADKTLPRSLTLKSSMVYSTPNVKTEGVWSS 147
             :.|..     |.|....|:|   |...:||:.:...|.:.:.||...:.||:|.:         
Human   265 -FQVAL-----FGRFYTDLIPVMEDTGIQRGIWDGDAKAVQQCLTDIFTSVYTTCD--------- 314

  Fly   148 GVIPRGTRFGPFEGIPTSNYPN---------DKNKARYFWRVQGTRHITYGNIKIFKDDDYYYLD 203
              ||....|||.....||.|.:         ||....|.:||                       
Human   315 --IPENAIFGPCVLSHTSLYDSIAFIALKSTDKRTVPYIFRV----------------------- 354

  Fly   204 GSDRSQSN-------WMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDFASR 261
              |.|.:|       |:|.|.||......||.|......:::.:.|.|..:|||:|||.|:.   
Human   355 --DTSAANGSSEGLMWLRLVQSARDKEEQNLEAYIKNGQLFYRSLRRIAKDEELLVWYGKEL--- 414

  Fly   262 LGYDVDPETTIFGACKQAVEAEEEADEEEEEAEGEDGKPRYSMPAPEIPPDVAVSHITYVMGLHL 326
                    |.:...|                       |..|                     |.
Human   415 --------TELLLLC-----------------------PSRS---------------------HN 427

  Fly   327 PVGAGNGPANGSVAGSVSGATPPPPTATPCCRRSSPPAHVSTTTSTCNAHHPHIQHGR------- 384
            .:.||:.|.                |...|.:|             .....|::.|.|       
Human   428 KMNAGSSPY----------------TCLECSQR-------------FQFEFPYVAHLRFRCPKRL 463

  Fly   385 HASVIIGQDRSPMASSDKDTAGSPLSGLDHQMTPQDGSVRSVRSDEGYHSNECHEDGLTPPEDSS 449
            |::.|..||........||..|....|.|.|...|:..:       |.....|....|       
Human   464 HSADISPQDEQGGGVGTKDHGGGGGGGKDQQQQQQEAPL-------GPGPKFCKAGPL------- 514

  Fly   450 DSESEHNYVLDCSKKAIAPKETVIAQAQKPSSSPPAVVMANTTTNSMISHSSPTATPICETDKNE 514
                 |:|                     ||.||       .::|...:....:|.|  .||.:.
Human   515 -----HHY---------------------PSPSP-------ESSNPSAAAGGSSAKP--STDFHN 544

  Fly   515 YRKFKVKMPLKYEFKN----KTCVKQEPSLKEVD--------QEMSLPQEEEEDQVMHPEPDSIC 567
                     |..|.:|    .:|...: ||....        ||..|            .||.|.
Human   545 ---------LARELENSRGGSSCSPAQ-SLSSGSGSGGGGGHQEAEL------------SPDGIA 587

  Fly   568 ----------PSTTTHLGDEHMLMMERERERERERIQERE----PSNQQPASSTVIVLEHNSGGQ 618
                      |......|....|:..|.|..||.....:|    ...|..||.:...||.|    
Human   588 TGGGKGKRKFPEEAAEGGGGAGLVGGRGRFVERPLPASKEDLVCTPQQYRASGSYFGLEEN---- 648

  Fly   619 ARTIVPLSKPYYEPDPPGERYMRFGQPSSSILETILTSQHRLEAAAAAANACRQANAATPPPTSP 683
            .|...|       |.|......|     |:.:|        ::.||.||:...:..|.       
Human   649 GRLFAP-------PSPETGEAKR-----SAFVE--------VKKAARAASLQEEGTAD------- 686

  Fly   684 TEMAYSYKKSQRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQEMTRATMIKGECSPPP----PSH 744
                         |..|:.:.....|.......::|..||.:::         .:|.|    ||.
Human   687 -------------GAGVASEDQDAGGGGGSSTPAAASPVGAEKL---------LAPRPGGPLPSR 729

  Fly   745 HHHNVIFSPSRHAAY-----LG-AGE-AGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQ 802
            ....   ||:|.:|:     || ||. :||.....|..|....|..|.|.            :|:
Human   730 LEGG---SPARGSAFTSVPQLGSAGSTSGGGGTGAGAAGGAGGGQGAASD------------ERK 779

  Fly   803 SNASSGAGSATNLHLLQTSTQMLNHPL--MQPLTPLQRLSPLRISPPS----------------- 848
            |..|..|.|.:     |.|..:|...|  ::|..|...:.|.|:.|.:                 
Human   780 SAFSQPARSFS-----QLSPLVLGQKLGALEPCHPADGVGPTRLYPAAADPLAVKLQGAADLNGG 839

  Fly   849 --SLSPDGNSCPR-------------------------SGSPL-----SPNSLASRGYRSLPYPL 881
              ||...|...|:                         :..||     |..:|....:.||..|.
Human   840 CGSLPSGGGGLPKQSPFLYATAFWPKSSAAAAAAAAAAAAGPLQLQLPSALTLLPPSFTSLCLPA 904

  Fly   882 KKKDGKMHYECNVCCKTFGQLSNLKVHLRTH-------------SGERPFKCNVCTKSFTQLAHL 933
            :.       .|..|..:|...|:|..|:|:|             ..|...||.:|.:||.:..||
Human   905 QN-------WCAKCNASFRMTSDLVYHMRSHHKKEYAMEPLVKRRREEKLKCPICNESFRERHHL 962

  Fly   934 QKHHLVH 940
            .:|...|
Human   963 SRHMTSH 969

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614 36/143 (25%)
C2H2 Zn finger 892..912 CDD:275368 7/20 (35%)
zf-H2C2_2 904..929 CDD:290200 10/38 (26%)
C2H2 Zn finger 920..940 CDD:275368 7/20 (35%)
zf-H2C2_2 932..957 CDD:290200 4/10 (40%)
C2H2 Zn finger 948..968 CDD:275368
zf-H2C2_2 960..985 CDD:290200
C2H2 Zn finger 976..996 CDD:275368
C2H2 Zn finger 1004..1023 CDD:275368
PRDM8XP_011530435.1 SET 309..411 CDD:279228 35/138 (25%)
C2H2 Zn finger 908..928 CDD:275368 7/20 (35%)
zf-C2H2 948..969 CDD:278523 8/21 (38%)
C2H2 Zn finger 949..969 CDD:275368 7/20 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.