DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and prdm11

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:XP_693848.3 Gene:prdm11 ZFINID:ZDB-GENE-061221-1 Length:1115 Species:Danio rerio

Alignment Length:616 Identity:134/617 (22%)
Similarity:206/617 (33%) Gaps:178/617 (29%)


  Fly    62 HHKLSARRARSRSRS-RSPTPDGNQDYDVTRMREEDF----ERLAVYL-----------VPDVQA 110
            |..:.|:...|.|.| ...|.:.|:...|...|...|    |....||           |||...
Zfish    10 HSSMEAKGECSTSASNEKSTEEPNKRLKVEHERYSSFWFCEECKKYYLEDCPTHGPPVFVPDTPV 74

  Fly   111 ERGLPNRADKTLPRSLTLKSSMVYSTPNVKTEGVWSSGVIPRGTRFGPFEGIPTSNYPNDKNKAR 175
            ..|:||||..|.|..:.::.:      ..|.:.......||:|..|||::|   ....:||....
Zfish    75 VSGVPNRAALTAPSGIEVRRN------GDKVDVYCMDEKIPKGALFGPYKG---QIMASDKPSGP 130

  Fly   176 YFWRVQGTRHITYGNIKIFKDDDYYYLDGSDRSQSNWMRYVASAYSLSVMNLVACQHQENIYFYT 240
            |.|.:            :.||..|.::||||.:.:||||::......|..||.|.||.:.|||..
Zfish   131 YSWMI------------VDKDSKYKFIDGSDEATANWMRFIHITSDESEQNLSAFQHGDQIYFRV 183

  Fly   241 TRDILPNEELMVWYCKDFASRL------GYDVDPETTIFGACKQAVEAEEEADEEEEEAEGEDGK 299
            ...:...|:|.|||..::..||      ..|.:.:|.:             ..|::||.:|    
Zfish   184 CHRLKVGEKLGVWYSSEYMKRLQSVSRDSIDHNLDTGV-------------KSEDQEEPKG---- 231

  Fly   300 PRYSMPAPEIPPDVAVSHITYVMGLHLPVGAGNGP--------------------ANGSVAGSVS 344
                      |...:..|....:..|....|.|.|                    ||.|....::
Zfish   232 ----------PVLRSAMHGRRTLSKHGSDEAENQPQAKKKKIDLIFKDVLEASLEANQSQNNPLN 286

  Fly   345 GATPPPPTATPCCRRSSPP-----AHVSTTTSTCNAHHPHIQHGRHASVIIGQDRSPMASSDKDT 404
            .....|...|..|:....|     ..|.|:......||.....|:...:...::...:.|....|
Zfish   287 STLSFPRARTNVCQVFCHPDAESKESVFTSGLVSMDHHEIGFDGKCIKMENTEEDEALTSEGPST 351

  Fly   405 AGSP-----------LSGLDHQMTPQ-DGSVRSVRSDEGYHSNECHEDGLTP-----PEDSSDSE 452
            :..|           |....|::..| ...|:.|.:.| ..:.|.|.|.:||     .||..|  
Zfish   352 SFCPNCVRLKRRIRELEAELHRLRGQGHAEVKPVPASE-MLAGEDHRDTMTPIPAALEEDDQD-- 413

  Fly   453 SEHNYVLDCSKKAIAPKETVIAQAQKPSSSPPAV-------------------VMANTTTNSMIS 498
                  :|.:.::|:....|.|.    .||..:|                   :..:.|.|.|..
Zfish   414 ------VDSADESISADLLVAAD----ESSKLSVGSGRRIRRFKQEWLKKFWFLRYSPTLNEMWC 468

  Fly   499 H--------SSPTATPICETDKNEYRKFKVKMPLKYEFKN--KTCVKQEPSLKEVDQEMSLPQEE 553
            |        ||.|:..|..:     ::||:.....:...|  |.|: |...|:            
Zfish   469 HVCRQYTVQSSRTSAFIIGS-----KQFKIHTIKLHSQSNLHKKCL-QLYKLR------------ 515

  Fly   554 EEDQVMHPE-PDSICPSTTTHLGDEHMLMME 583
                 |||| .:.:|.:..|.|...:.|.:|
Zfish   516 -----MHPEKTEEMCRNMMTLLNAAYHLALE 541

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614 37/127 (29%)
C2H2 Zn finger 892..912 CDD:275368
zf-H2C2_2 904..929 CDD:290200
C2H2 Zn finger 920..940 CDD:275368
zf-H2C2_2 932..957 CDD:290200
C2H2 Zn finger 948..968 CDD:275368
zf-H2C2_2 960..985 CDD:290200
C2H2 Zn finger 976..996 CDD:275368
C2H2 Zn finger 1004..1023 CDD:275368
prdm11XP_693848.3 SET 90..202 CDD:214614 37/133 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 1 0.900 E1_KOG2461
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.