DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and CG7963

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_649798.3 Gene:CG7963 FlyBaseID:FBgn0037584 Length:339 Species:Drosophila melanogaster

Alignment Length:170 Identity:59/171 (35%)
Similarity:93/171 (54%) Gaps:12/171 (7%)


  Fly   854 GNSCPRSGSPL-SPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERP 917
            |:.|...|..| |.:||||.        ::....:..:.|:.|.|.|.....|:||.|.|.....
  Fly   186 GHKCLECGKCLQSASSLASH--------IRLHTDEWPFTCDQCAKAFRTNGALEVHQRRHKQVLQ 242

  Fly   918 FKCNVCTKSFTQLAHLQKHHLV--HTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCP 980
            .||..|.:.|.:.::|:: |:|  ||.|:||.|::.::.||....|:.|||.::|::||||....
  Fly   243 HKCLHCGRGFVESSNLRR-HIVNRHTEERPHLCNVYQRSFSRVYMLELHLRTNTGERPYACQHRD 306

  Fly   981 QKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTH 1020
            ::|.|...||:|:|:||.:|.:.||.|:|.:..|..||.|
  Fly   307 KRFAQLGVLKIHERIHTGERLHRCQVCEKPFTRAGQLRKH 346

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 8/20 (40%)
zf-H2C2_2 904..929 CDD:290200 9/25 (36%)
C2H2 Zn finger 920..940 CDD:275368 6/22 (27%)
zf-H2C2_2 932..957 CDD:290200 11/27 (41%)
C2H2 Zn finger 948..968 CDD:275368 7/20 (35%)
zf-H2C2_2 960..985 CDD:290200 10/25 (40%)
C2H2 Zn finger 976..996 CDD:275368 7/20 (35%)
C2H2 Zn finger 1004..1023 CDD:275368 8/18 (44%)
CG7963NP_649798.3 zf-AD 10..80 CDD:285071
C2H2 Zn finger 159..179 CDD:275368
COG5048 184..>250 CDD:227381 21/72 (29%)
C2H2 Zn finger 189..209 CDD:275368 8/28 (29%)
C2H2 Zn finger 217..237 CDD:275368 8/20 (40%)
C2H2 Zn finger 245..262 CDD:275368 5/18 (28%)
C2H2 Zn finger 274..294 CDD:275368 7/20 (35%)
C2H2 Zn finger 302..322 CDD:275368 7/20 (35%)
zf-H2C2_2 315..339 CDD:290200 11/24 (46%)
C2H2 Zn finger 330..350 CDD:275368 8/18 (44%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 P PTHR16515
RoundUp 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.