DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and CG11906

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_611402.2 Gene:CG11906 FlyBaseID:FBgn0034425 Length:634 Species:Drosophila melanogaster

Alignment Length:813 Identity:147/814 (18%)
Similarity:225/814 (28%) Gaps:299/814 (37%)


  Fly   360 SSPPAHVSTTTSTCNAHHPH--IQHGRHASVIIGQDRSPMASSDKDTA-----GSPLSGL--DHQ 415
            ::|....|:|...|:..|.:  .|...|    :|.:|...|:....|.     .|.|..|  :|.
  Fly     5 TAPDPEPSSTNGNCSVEHDNRQDQDENH----VGAEREAEANDANCTVCGAAKASALLDLRSNHV 65

  Fly   416 MTPQDGSVRSVRSDEGYHSNECHEDGLTPPEDSSDSESEHNYVLDCSKKAIAPK----------- 469
            |.      |.:..|...|::                      |:..:.|||..:           
  Fly    66 MQ------RRLSRDWKIHAD----------------------VIRSTLKAICVECVCKLNMHSEV 102

  Fly   470 -ETVIAQAQKPSSSPPAVVMANTTTNSMISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNKTC 533
             .:::.:.|:...|........|||.|...||.|.|                             
  Fly   103 TRSLMQRMQRLQRSGGETTKVTTTTTSPSQHSPPIA----------------------------- 138

  Fly   534 VKQEPSLKEVDQEMSLPQEEEEDQVMHP----EPDSICPSTTTHLGDEHMLMMERERERERERIQ 594
                      |.|:|....|.:::|.|.    ...|.|.....:|.                   
  Fly   139 ----------DAEVSTTLIESQEEVAHSGQSVRSRSSCSVLEVYLA------------------- 174

  Fly   595 EREPSNQQPASSTVIVLE--HNSGGQARTIV---PLSKPYYEPDPPGERYMRFG-------QPSS 647
                  |||.|.:....|  |..|.:.||.:   ...:.|:..|...:...|..       :||.
  Fly   175 ------QQPYSPSAKETEEKHAEGWKWRTRLECHECGRAYFRRDYYAQHLRRCSKTRRKQPRPSR 233

  Fly   648 SILETILTSQHRLEAAAAAANA-----CRQANAATPPPTSPTEMAYSYKKSQRYGNAVSPDSSSN 707
            .....:..:.:..||.:.|..:     ||..:|......|..:.. ..|..|||           
  Fly   234 VKCRVLNEASYDEEAPSRAIRSSRIYYCRHCDAEFETLISKRQHE-RMKHQQRY----------- 286

  Fly   708 LGQNPEQLSSSAV-VVGEQEMTRATMIKGECSPPPPSHHHHNVIFSPSRHAAYLGAGEAGGHSPS 771
                |..|..:.: ...|.||                  ||.:..:.....|.:...|||....:
  Fly   287 ----PCDLCEAQLDTKYEWEM------------------HHTICQAKQEALAIVEQQEAGQTVMT 329

  Fly   772 PGYPGYPHYGAAATSTFHSPPHSSHSPFDR-----------QSNASSGA-----GSATNLHLLQ- 819
            ...|        ...:..|...:....:||           .....||.     |....::..: 
  Fly   330 SRVP--------RACSMRSRSRACSEAWDRYDMDEEEEDEEDEEIESGGEELEEGEEDAMYARRM 386

  Fly   820 --TSTQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNSCPRSGSPLSPNSLASRGYRSLPYPLK 882
              |...::||                              .||.|       .|.|..||.|   
  Fly   387 NFTGDWIVNH------------------------------SRSNS-------NSAGNLSLLY--- 411

  Fly   883 KKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF--------KCNVCTKSFT----------- 928
                             |....::.|:.|   ::.:        |..|..||||           
  Fly   412 -----------------GDYGMVETHMTT---DKEYDLYLLDLLKTQVRLKSFTCFTPDCGYQTD 456

  Fly   929 QLAHLQKH-HLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLH 992
            .|..|.|| ::.|.......|..|...|:|...|..|:.|.: :..|.|..|.::|.....|..|
  Fly   457 TLVALMKHDYMEHWKMSWFYCHKCGDVFTSKVFLDYHMHLQN-RGLYICHKCREEFELQHQLDRH 520

  Fly   993 KRLHTNDRPYVCQGCDKKYISASGLRTHWKTTSCKPN-----NLEEELAMAAAATSECLD----- 1047
            .:||.....|.|..|..:::|.:.|..|.|.....||     :::..|::.........|     
  Fly   521 FQLHRKGINYHCNFCRLEFLSEAKLLAHCKKLGHSPNDEPLISIDRSLSIVNCHVPRSSDYSRIV 585

  Fly  1048 KDHPEPDSREAY-----EQLTQHMHPAVHPGLR 1075
            |.:.|   ||.|     ...||.||...|...|
  Fly   586 KSYEE---REFYIPRIPMPSTQPMHLPQHKPFR 615

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 3/20 (15%)
zf-H2C2_2 904..929 CDD:290200 8/44 (18%)
C2H2 Zn finger 920..940 CDD:275368 9/32 (28%)
zf-H2C2_2 932..957 CDD:290200 7/26 (27%)
C2H2 Zn finger 948..968 CDD:275368 7/20 (35%)
zf-H2C2_2 960..985 CDD:290200 7/25 (28%)
C2H2 Zn finger 976..996 CDD:275368 6/20 (30%)
C2H2 Zn finger 1004..1023 CDD:275368 6/19 (32%)
CG11906NP_611402.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123612275
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.