DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and wor

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_476601.1 Gene:wor / 34906 FlyBaseID:FBgn0001983 Length:548 Species:Drosophila melanogaster


Alignment Length:614 Identity:129/614 - (21%)
Similarity:213/614 - (34%) Gaps:177/614 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   593 IQEREPSNQQPASSTVIVLEHNSG----GQARTIVPLSKPYY----EPDP---PGERYMRFGQPS 646
            ::|..|.:.         |.|:.|    ..|...||: :|::    ||:|   |.|...||    
  Fly    18 VEESSPEDH---------LSHDEGPVDLSVASAAVPM-EPHWMAKSEPEPQPVPTELRRRF---- 68

  Fly   647 SSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGNAVSPDSSSNLGQN 711
                 ....:|.:.:.|.......|:...|.|...:..|:|.|..: ..||....|.....:...
  Fly    69 -----DAAMNQTKEQLARRIWEETREIARAFPDVFTREEIAKSLAR-LGYGEFELPPEEEVMEPE 127

  Fly   712 PEQLSSSAVVVGEQEM----TR---ATMIKGECSPP---PPSHHHHNVIFSPSRHAAYL---GAG 763
            ||.         ||.:    ||   .|:||.|.|..   |..::::|::.|.:.:...:   ...
  Fly   128 PEP---------EQHLPLRYTRDASPTIIKAEPSDEEQFPLRNYNNNLLKSIAEYEDCMKMQNIK 183

  Fly   764 EAGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHP 828
            |.....|||             ..|:.||.....|.|.         |.|...:|..:..:.|  
  Fly   184 EEIPPIPSP-------------QLFYPPPTPLAEPEDL---------SVTQRRVLSENMNLQN-- 224

  Fly   829 LMQPLTPLQRLSPLRISPPSSLSPDG-----------------------NSCPRSGSPLSPNSLA 870
            :.:.|..:|.::|....||..:..|.                       |.|..:.:.|..:. .
  Fly   225 VARALLSMQHMAPQHAPPPIDMEEDQENQDINQLKIKSSNDLYYQCQQCNKCYATYAGLVKHQ-Q 288

  Fly   871 SRGYRSLPY-------------------------------------PLKKKDGKMHYECNVCCKT 898
            :..|.|..|                                     .::|..|...|.|..|.|:
  Fly   289 THAYESTEYKIIRSQPGGSGAIVDQTEFCTDQASALIQAANVASAQSMQKPVGVPRYHCQDCGKS 353

  Fly   899 FGQLSNLKVHLRTH--SGE-----RPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFS 956
            :...|.|..|.:.|  |.|     :.|.|..|.|::..|..|:.|...||  .|.:|.||.|.||
  Fly   354 YSTYSGLSKHQQFHCPSAEGNQVKKVFSCKNCDKTYVSLGALKMHIRTHT--LPCKCPICGKAFS 416

  Fly   957 STSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHW 1021
            ....|:.|:|.|:|:||::|..|.:.|....:|:.|.:.|::.:.|.|..|.|.:...|.|..|.
  Fly   417 RPWLLQGHIRTHTGEKPFSCQHCNRAFADRSNLRAHMQTHSDVKKYSCPTCTKSFSRMSLLAKHL 481

  Fly  1022 KTTSCKPNNLEEELAMAAAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQSPPR 1086
            : :.|     :.|.:...:.:....|:           :||.||:         .:...|.:|.:
  Fly   482 Q-SGC-----QTEQSGGPSGSGGGFDQ-----------QQLQQHL---------QVYEEGHNPHQ 520

  Fly  1087 LIPLGNHMAPQQQSHQQQQQQHQQQGVPP 1115
            |...|:  .......:::..::|.|  ||
  Fly   521 LYYAGS--VGSSNGEEEEGGEYQMQ--PP 545

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 6/19 (32%)
zf-H2C2_2 904..929 CDD:290200 9/31 (29%)
C2H2 Zn finger 920..940 CDD:275368 6/19 (32%)
zf-H2C2_2 932..957 CDD:290200 10/24 (42%)
C2H2 Zn finger 948..968 CDD:275368 9/19 (47%)
zf-H2C2_2 960..985 CDD:290200 10/24 (42%)
C2H2 Zn finger 976..996 CDD:275368 5/19 (26%)
C2H2 Zn finger 1004..1023 CDD:275368 6/18 (33%)
worNP_476601.1 C2H2 Zn finger 270..290 CDD:275368 3/20 (15%)
C2H2 Zn finger 317..334 CDD:275368 0/16 (0%)
zf-C2H2 345..367 CDD:278523 7/21 (33%)
C2H2 Zn finger 347..367 CDD:275368 6/19 (32%)
PHA00732 379..>417 CDD:177300 15/39 (38%)
C2H2 Zn finger 382..402 CDD:275368 6/19 (32%)
zf-C2H2_8 405..482 CDD:292531 27/76 (36%)
zf-C2H2 406..428 CDD:278523 9/21 (43%)
C2H2 Zn finger 408..428 CDD:275368 9/19 (47%)
zf-H2C2_2 421..444 CDD:290200 9/22 (41%)
zf-C2H2 434..456 CDD:278523 5/21 (24%)
C2H2 Zn finger 436..456 CDD:275368 5/19 (26%)
zf-H2C2_2 448..473 CDD:290200 7/24 (29%)
C2H2 Zn finger 464..481 CDD:275368 5/16 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45457157
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.