| Sequence 1: | NP_001261442.1 | Gene: | Blimp-1 / 38638 | FlyBaseID: | FBgn0035625 | Length: | 1216 | Species: | Drosophila melanogaster | 
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_476601.1 | Gene: | wor / 34906 | FlyBaseID: | FBgn0001983 | Length: | 548 | Species: | Drosophila melanogaster | 
| Alignment Length: | 614 | Identity: | 129/614 - (21%) | 
|---|---|---|---|
| Similarity: | 213/614 - (34%) | Gaps: | 177/614 - (28%) | 
- Green bases have known domain annotations that are detailed below.
| 
  Fly   593 IQEREPSNQQPASSTVIVLEHNSG----GQARTIVPLSKPYY----EPDP---PGERYMRFGQPS 646 
  Fly   647 SSILETILTSQHRLEAAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGNAVSPDSSSNLGQN 711 
  Fly   712 PEQLSSSAVVVGEQEM----TR---ATMIKGECSPP---PPSHHHHNVIFSPSRHAAYL---GAG 763 
  Fly   764 EAGGHSPSPGYPGYPHYGAAATSTFHSPPHSSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHP 828 
  Fly   829 LMQPLTPLQRLSPLRISPPSSLSPDG-----------------------NSCPRSGSPLSPNSLA 870 
  Fly   871 SRGYRSLPY-------------------------------------PLKKKDGKMHYECNVCCKT 898 
  Fly   899 FGQLSNLKVHLRTH--SGE-----RPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFS 956 
  Fly   957 STSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHW 1021 
  Fly  1022 KTTSCKPNNLEEELAMAAAATSECLDKDHPEPDSREAYEQLTQHMHPAVHPGLRHLSSGGQSPPR 1086 
  Fly  1087 LIPLGNHMAPQQQSHQQQQQQHQQQGVPP 1115 | 
| Gene | Sequence | Domain | Region | External ID | Identity | 
|---|---|---|---|---|---|
| Blimp-1 | NP_001261442.1 | SET | 133..260 | CDD:214614 | |
| C2H2 Zn finger | 892..912 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 904..929 | CDD:290200 | 9/31 (29%) | ||
| C2H2 Zn finger | 920..940 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 932..957 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 948..968 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 960..985 | CDD:290200 | 10/24 (42%) | ||
| C2H2 Zn finger | 976..996 | CDD:275368 | 5/19 (26%) | ||
| C2H2 Zn finger | 1004..1023 | CDD:275368 | 6/18 (33%) | ||
| wor | NP_476601.1 | C2H2 Zn finger | 270..290 | CDD:275368 | 3/20 (15%) | 
| C2H2 Zn finger | 317..334 | CDD:275368 | 0/16 (0%) | ||
| zf-C2H2 | 345..367 | CDD:278523 | 7/21 (33%) | ||
| C2H2 Zn finger | 347..367 | CDD:275368 | 6/19 (32%) | ||
| PHA00732 | 379..>417 | CDD:177300 | 15/39 (38%) | ||
| C2H2 Zn finger | 382..402 | CDD:275368 | 6/19 (32%) | ||
| zf-C2H2_8 | 405..482 | CDD:292531 | 27/76 (36%) | ||
| zf-C2H2 | 406..428 | CDD:278523 | 9/21 (43%) | ||
| C2H2 Zn finger | 408..428 | CDD:275368 | 9/19 (47%) | ||
| zf-H2C2_2 | 421..444 | CDD:290200 | 9/22 (41%) | ||
| zf-C2H2 | 434..456 | CDD:278523 | 5/21 (24%) | ||
| C2H2 Zn finger | 436..456 | CDD:275368 | 5/19 (26%) | ||
| zf-H2C2_2 | 448..473 | CDD:290200 | 7/24 (29%) | ||
| C2H2 Zn finger | 464..481 | CDD:275368 | 5/16 (31%) | ||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 1 | 0.930 | - | - | C45457157 | |
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 0 | 0.000 | Not matched by this tool. | |||
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 0.930 | |||||