DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and prdm1a

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_955809.2 Gene:prdm1a ZFINID:ZDB-GENE-030131-2193 Length:776 Species:Danio rerio

Alignment Length:1058 Identity:312/1059 (29%)
Similarity:414/1059 (39%) Gaps:364/1059 (34%)


  Fly    85 QDYDVTRMREEDFERLAVYLVPDVQAERGLPN----RADKTLPRSLTLKSSMVYSTPNVKTEGVW 145
            :|.|:|:..|::||....|:|.|...|..|.|    ||:.:|||:|..|    :...:.:..||.
Zfish    37 EDVDMTKWTEDEFEEKCTYIVKDHTWEGPLENTDLTRAEASLPRNLAFK----HPADSKEVIGVV 97

  Fly   146 SSGVIPRGTRFGPF--EGIPTSNYPNDKNKARYFWRVQGTRHITYGNIKIFKDDDY-YYLDGSDR 207
            |...||:||||||.  |.....|.|.|.|: :||||             |:.|.:: :::||.|.
Zfish    98 SREYIPKGTRFGPLVGESYTAENVPKDANR-KYFWR-------------IYSDGEFHHFVDGLDE 148

  Fly   208 SQSNWMRYVASAYSLSVMNLVACQHQENIYFYTTRDILPNEELMVWYCKDFASRLGYDVDPETTI 272
            .:|||||||..|:|....||.|||:..||||||.:.|..::||:||||.:||.||.|....|..:
Zfish   149 EKSNWMRYVNPAHSQQEQNLAACQNGMNIYFYTVKAIPADQELLVWYCPEFARRLNYPASGEIMM 213

  Fly   273 FGACKQAVEAEEEADEEEEEAEGEDGKPRYSMPAPEIPPDVAVSHITYVMGLHLPVGAGNGPANG 337
            ....:..:||:::|.|.:...:.|..       ..||..||          |..|          
Zfish   214 QKLKQSLIEAKQQATEVKHPVKREHS-------VSEILKDV----------LQEP---------- 251

  Fly   338 SVAGSVSGATPPPPTATPCCRRSSPPAHVSTTTSTCNAHHPHIQHGRHASVIIGQDRSPMASSDK 402
                     :.|.||...|.:....|.:.|       |.:|                 |..|.::
Zfish   252 ---------SRPLPTRPRCPKSPDRPLYPS-------AVYP-----------------PRPSLNE 283

  Fly   403 D-TAGSPLSGLDHQMTPQDGSVRSVRSDEGYHSNECHEDGLTPPEDSSDSESEHNYVLDCSKKAI 466
            | ...:.:.||            ..||    |: :|   .:||      |.|.|:          
Zfish   284 DFLKSTTVFGL------------PTRS----HT-QC---SVTP------SPSAHS---------- 312

  Fly   467 APKETVIAQAQKPSSSPPAVVMANTTTNSMISHSSPTATPICETDKNEYRKFKVKMPLKYEFKNK 531
                       .|..||               .||||:..|                        
Zfish   313 -----------SPERSP---------------GSSPTSASI------------------------ 327

  Fly   532 TCVKQEPSLKEVDQEMSLPQEEEEDQVMHPEPDSICPSTTTHLGDEHMLMMERERERERERIQER 596
                 ||      :|..||               ..|:.... |..|.                 
Zfish   328 -----EP------REAFLP---------------FSPALYNR-GLNHY----------------- 348

  Fly   597 EPSNQQPASSTVIVLEHNSGGQARTIVPLSKPYYEPDPPGERYMRFGQPSSSILETILTSQHRLE 661
              ....||.                    |.|:| |:|...||:....|.||:            
Zfish   349 --PGYSPAG--------------------SMPFY-PNPHYSRYLMHHYPVSSL------------ 378

  Fly   662 AAAAAANACRQANAATPPPTSPTEMAYSYKKSQRYGNAVSPDSSSNLGQNPEQLSSSAVVVGEQE 726
                           :.|.|......:.|   ..|.:.|.|    ::...|..|||        |
Zfish   379 ---------------SGPSTLGGIFPHMY---PFYSSLVPP----HVPFPPSMLSS--------E 413

  Fly   727 MTRATMIKGECSPPPPSHHHHNVIFSPSRHAAYLGAGEAGGHSPSPGYPGYPHYGAAATSTFHSP 791
            .:|..|:      ||.|....:::. |:..:|:                      :||||....|
Zfish   414 GSRQFML------PPDSPAPRDILL-PAATSAF----------------------SAATSLKDKP 449

  Fly   792 PHSSHSPFDRQSNASSGAGSATNLHLLQTSTQMLNHPLMQPLTPLQRLSPLRISPPSSLSPDGNS 856
            .|....|: ..:..|..||||.:...:.|                        .|.|::.    |
Zfish   450 LHGHGHPY-APAGGSPTAGSAASTGCIPT------------------------KPTSAIL----S 485

  Fly   857 CPRSGSP---LSPNSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPF 918
            ..||...   ||.....|.||:||.|||||::||:.||||||.||||||||||||||.|||||||
Zfish   486 TSRSEDEAINLSKMKRGSTGYKSLDYPLKKQNGKIKYECNVCTKTFGQLSNLKVHLRVHSGERPF 550

  Fly   919 KCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKF 983
            ||..|.|.||||||||||:|||||||||:|.:|.||||||||||||||||||:|||.|.:||.||
Zfish   551 KCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKICPAKF 615

  Fly   984 TQFVHLKLHKRLHTNDRPYVCQGCDKKYISASGLRTHWK--------TTSC---KPNNLEEE--- 1034
            ||||||||||||||.:||:.|..|...||..|.||.|.|        :.||   :.|.:.||   
Zfish   616 TQFVHLKLHKRLHTRERPHQCPHCHHNYIHLSSLRFHLKGYCLAVSPSPSCSLDELNRVNEEIER 680

  Fly  1035 --LAMAAAATSECLDKDHPEPDSREAYEQLTQHM--HPAVHPGLRHLSSGGQSPPRLIPLGNHMA 1095
              ::..|....|....|......::.:..|.|.|  ..:.|.|    |:||...||...|..:..
Zfish   681 FDISDNADRLEEMEGFDVEGMVEKQIFGLLWQEMDFKASYHKG----STGGDLHPRAPALSAYHL 741

  Fly  1096 PQQQSHQQQQQQHQQQGV 1113
            .:..|.....:.|:...:
Zfish   742 NEHDSEASVIKVHRSSPI 759

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614 54/130 (42%)
C2H2 Zn finger 892..912 CDD:275368 18/20 (90%)
zf-H2C2_2 904..929 CDD:290200 20/25 (80%)
C2H2 Zn finger 920..940 CDD:275368 15/20 (75%)
zf-H2C2_2 932..957 CDD:290200 20/25 (80%)
C2H2 Zn finger 948..968 CDD:275368 17/20 (85%)
zf-H2C2_2 960..985 CDD:290200 20/25 (80%)
C2H2 Zn finger 976..996 CDD:275368 17/20 (85%)
C2H2 Zn finger 1004..1023 CDD:275368 9/27 (33%)
prdm1aNP_955809.2 SET 95..200 CDD:214614 53/119 (45%)
Latrophilin <236..344 CDD:280509 43/281 (15%)
COG5048 <517..634 CDD:227381 96/117 (82%)
zf-C2H2 522..544 CDD:278523 20/22 (91%)
C2H2 Zn finger 524..544 CDD:275368 18/20 (90%)
zf-H2C2_2 536..561 CDD:290200 20/25 (80%)
C2H2 Zn finger 552..572 CDD:275368 15/20 (75%)
zf-H2C2_2 564..589 CDD:290200 20/25 (80%)
C2H2 Zn finger 580..600 CDD:275368 17/20 (85%)
zf-H2C2_2 592..617 CDD:290200 20/25 (80%)
C2H2 Zn finger 608..628 CDD:275368 17/20 (85%)
zf-H2C2_2 620..>640 CDD:290200 14/20 (70%)
C2H2 Zn finger 636..654 CDD:275368 8/18 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C359111552
eggNOG 1 0.900 E1_KOG2461
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 408 1.000 Inparanoid score I1813
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 D233655at33208
OrthoFinder 1 1.000 FOG0003647
OrthoInspector 1 1.000 T596132
orthoMCL 1 0.900 OOG5_133653
Panther 1 1.100 LDO PTHR16515
Phylome 1 0.910 0.750 Consistency score
RoundUp 1 1.030 avgDist Average_Evolutionary_Distance R4128
TreeFam 1 0.960
ZFIN 00.000 Not matched by this tool.
1211.790

Return to query results.
Submit another query.