DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Blimp-1 and CG42726

DIOPT Version :9

Sequence 1:NP_001261442.1 Gene:Blimp-1 / 38638 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 / 318709 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster


Alignment Length:353 Identity:94/353 - (26%)
Similarity:147/353 - (41%) Gaps:83/353 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   881 LKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKP 945
            |||      :.|..|.:.|...|:||.||.:|..:....|:||.|||.|...||:|.|.|..|| 
  Fly    98 LKK------FNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK- 155

  Fly   946 HQCDICKKRFSSTSNLKTHLRLHS--GQKPYACDLCPQKFTQFVHLKLHKRLH-TNDRPYVCQGC 1007
            |.|.||:|.|...|:|.:||.:||  |.: :.|:||.:.|....:|..|.|.| .|:..::|:.|
  Fly   156 HLCPICQKVFRRKSSLASHLAIHSDLGLQ-FKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVC 219

  Fly  1008 DKKYISASGLRTHWKTTSCKPNNLEEELAMAAAATSECLDKDHPEPD----------SREAY--- 1059
            .|.::..:.||.|.|    :.:|.|.:      :.|.| .|.:.:||          :.|.|   
  Fly   220 QKSFLRQTTLRLHMK----RHSNRERQ------SCSLC-GKSYNDPDALGRHLRQHKTAERYRCI 273

  Fly  1060 ---------EQLTQHMHPAVHPGLRHLSSGGQSPPRLIPLGNHMAPQQQSHQQQQQQHQQQGVPP 1115
                     :.:.:|:. ::|||....|:.....||             |..|:....:::....
  Fly   274 QCDITINRKDNMLRHLR-SMHPGCAFASTVEMVTPR-------------SSAQEATTAEERPSQT 324

  Fly  1116 PHLLMTQHSVGPA-PMLLTTASQLPPPPPHHQQNSPSRLLQHGHAHPLQMQQQQQQQQQHSPKGL 1179
            ........|||.. |::|..::.||...|..|       ::.|.|.|           :|.|.. 
  Fly   325 VRYNSVIQSVGNVEPVMLLQSTPLPSQLPELQ-------MEKGKAVP-----------EHLPLP- 370

  Fly  1180 KSLPESGVYLHGQHV-----QAQESRPS 1202
            ..:||..|.|:.:.:     :...|.||
  Fly   371 DVMPEENVQLYRKIILDLDNEEYSSEPS 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 PR-SET_PRDM1 120..262 CDD:380964
zf-C2HE <871..912 CDD:465082 11/30 (37%)
C2H2 Zn finger 892..912 CDD:275368 8/19 (42%)
zf-H2C2_2 904..929 CDD:463886 11/24 (46%)
C2H2 Zn finger 920..940 CDD:275368 11/19 (58%)
SFP1 <938..1020 CDD:227516 31/84 (37%)
C2H2 Zn finger 948..968 CDD:275368 9/19 (47%)
C2H2 Zn finger 976..996 CDD:275368 7/19 (37%)
C2H2 Zn finger 1004..1023 CDD:275368 6/18 (33%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 8/19 (42%)
COG5048 <112..288 CDD:227381 58/188 (31%)
C2H2 Zn finger 131..151 CDD:275368 11/19 (58%)
C2H2 Zn finger 158..178 CDD:275368 9/19 (47%)
C2H2 Zn finger 187..207 CDD:275368 7/19 (37%)
C2H2 Zn finger 216..236 CDD:275368 7/23 (30%)
C2H2 Zn finger 244..264 CDD:275368 5/20 (25%)
C2H2 Zn finger 272..290 CDD:275368 1/17 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Software error:

Can't use an undefined value as an ARRAY reference at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 1034.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - -
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.