DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Blimp-1 and CG42726

Sequence 1:NP_001261442.1 Gene:Blimp-1 FlyBaseID:FBgn0035625 Length:1216 Species:Drosophila melanogaster
Sequence 2:NP_732017.3 Gene:CG42726 FlyBaseID:FBgn0261679 Length:441 Species:Drosophila melanogaster

Alignment Length:353 Identity:94/354 (27%)
Similarity:147/354 (42%) Gaps:83/354 (23%)


  Fly   881 LKKKDGKMHYECNVCCKTFGQLSNLKVHLRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKP 945
            |||      :.|..|.:.|...|:||.||.:|..:....|:||.|||.|...||:|.|.|..|| 
  Fly    98 LKK------FNCKECGRRFATSSHLKYHLMSHEKQSKHSCSVCHKSFKQPIVLQRHMLTHNQEK- 155

  Fly   946 HQCDICKKRFSSTSNLKTHLRLHS--GQKPYACDLCPQKFTQFVHLKLHKRLH-TNDRPYVCQGC 1007
            |.|.||:|.|...|:|.:||.:||  |.: :.|:||.:.|....:|..|.|.| .|:..::|:.|
  Fly   156 HLCPICQKVFRRKSSLASHLAIHSDLGLQ-FKCELCSKHFQNKANLNQHLRKHDKNNIRHMCKVC 219

  Fly  1008 DKKYISASGLRTHWKTTSCKPNNLEEELAMAAAATSECLDKDHPEPD----------SREAY--- 1059
            .|.::..:.||.|.|    :.:|.|.:      :.|.| .|.:.:||          :.|.|   
  Fly   220 QKSFLRQTTLRLHMK----RHSNRERQ------SCSLC-GKSYNDPDALGRHLRQHKTAERYRCI 273

  Fly  1060 ---------EQLTQHMHPAVHPGLRHLSSGGQSPPRLIPLGNHMAPQQQSHQQQQQQHQQQGVPP 1115
                     :.:.:|:. ::|||....|:.....||             |..|:....:::....
  Fly   274 QCDITINRKDNMLRHLR-SMHPGCAFASTVEMVTPR-------------SSAQEATTAEERPSQT 324

  Fly  1116 PHLLMTQHSVGPA-PMLLTTASQLPPPPPHHQQNSPSRLLQHGHAHPLQMQQQQQQQQQHSPKGL 1179
            ........|||.. |::|..::.||...|..|       ::.|.|.|           :|.|.. 
  Fly   325 VRYNSVIQSVGNVEPVMLLQSTPLPSQLPELQ-------MEKGKAVP-----------EHLPLP- 370

  Fly  1180 KSLPESGVYLHGQHV-----QAQESRPS 1202
            ..:||..|.|:.:.:     :...|.||
  Fly   371 DVMPEENVQLYRKIILDLDNEEYSSEPS 398

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Blimp-1NP_001261442.1 SET 133..260 CDD:214614
C2H2 Zn finger 892..912 CDD:275368 8/20 (40%)
zf-H2C2_2 904..929 CDD:290200 11/25 (44%)
C2H2 Zn finger 920..940 CDD:275368 11/20 (55%)
zf-H2C2_2 932..957 CDD:290200 13/25 (52%)
C2H2 Zn finger 948..968 CDD:275368 9/20 (45%)
zf-H2C2_2 960..985 CDD:290200 10/27 (37%)
C2H2 Zn finger 976..996 CDD:275368 7/20 (35%)
C2H2 Zn finger 1004..1023 CDD:275368 7/19 (37%)
CG42726NP_732017.3 C2H2 Zn finger 74..94 CDD:275368
C2H2 Zn finger 103..123 CDD:275368 8/20 (40%)
COG5048 <112..288 CDD:227381 58/189 (31%)
C2H2 Zn finger 131..151 CDD:275368 11/20 (55%)
Chordopox_A33R 151..>254 CDD:283591 37/116 (32%)
C2H2 Zn finger 158..178 CDD:275368 9/20 (45%)
C2H2 Zn finger 187..207 CDD:275368 7/20 (35%)
C2H2 Zn finger 216..236 CDD:275368 7/24 (29%)
C2H2 Zn finger 244..264 CDD:275368 5/21 (24%)
C2H2 Zn finger 272..290 CDD:275368 1/18 (6%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C123612520
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.