DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment: Alp10 and PHO8

Sequence 1:NP_647976.1 Gene:Alp10 FlyBaseID:FBgn0035619 Length:524 Species:Drosophila melanogaster
Sequence 2:NP_010769.3 Gene:PHO8 SGDID:S000002889 Length:566 Species:Saccharomyces cerevisiae

Alignment Length:516 Identity:143/517 (28%)
Similarity:219/517 (42%) Gaps:123/517 (24%)


  Fly    58 SILADKLAGHKKLNENRAKNVILFLGDGMSVHTIAATRAFMGDSNKQVFFEKFP----------Y 112
            |..|.:.|.|||      ||||.|:.|||...:::..|:|    |:.|  ...|          :
Yeast    55 SSFALRSASHKK------KNVIFFVTDGMGPASLSMARSF----NQHV--NDLPIDDILTLDEHF 107

  Fly   113 LGLSKTYAVNERTPDSANTATAYLTGVKANYGTIGVNAQVQRGDCVTNSSSHVQSIGQWAQEAGK 177
            :|.|:|.:.:....|||..|||:...:|:..|.|||:.  ....|.|        :.:.|:.||.
Yeast   108 IGSSRTRSSDSLVTDSAAGATAFACALKSYNGAIGVDP--HHRPCGT--------VLEAAKLAGY 162

  Fly   178 WAGLVTTARVTHASPAGVYAHVSERNWEHDGEIISSKCSPDVNTDIARQLVEWPVGQELRVIMGG 242
            ..|||.|.|:|.|:||...:||..| |:.|  :|::           .||.|:|:|:.:.::|||
Yeast   163 LTGLVVTTRITDATPASFSSHVDYR-WQED--LIAT-----------HQLGEYPLGRVVDLLMGG 213

  Fly   243 GRSYFRDQSQH-DETGVSGLRTDGRDLISDWREIKKQQGAEGKYVWSLKG----LKETDISKTDY 302
            |||:|..|.:. ...|..|.|.||||||.:      .|....:||...|.    ||....:.|..
Yeast   214 GRSHFYPQGEKASPYGHHGARKDGRDLIDE------AQSNGWQYVGDRKNFDSLLKSHGENVTLP 272

  Fly   303 LLGLFDTSHLPYHGDRRRTHYEDAEPSLSDMTEAAIKMLSK--NEE----GYFLFVESGRIDMAH 361
            .||||..:.:|:..||....|    |||.:..:.|:..|.|  ||:    |:||.||..|||.|.
Yeast   273 FLGLFADNDIPFEIDRDEKEY----PSLKEQVKVALGALEKASNEDKDSNGFFLMVEGSRIDHAG 333

  Fly   362 H----ATKAMKALEDTEEFAAAVELARKMTDEEDTLIVVTSDHSH---------TMSINGYPYRR 413
            |    |::..:.|...|.|...:|.|.  ..:.:|::|.||||..         |.|...|.:..
Yeast   334 HQNDPASQVREVLAFDEAFQYVLEFAE--NSDTETVLVSTSDHETGGLVTSRQVTASYPQYVWYP 396

  Fly   414 QNILSL--------------------APNLADDELPFTILSYANGPGFDDTYSTKDGRID-LSHA 457
            |.:.:.                    |.:..::.:...||....|     .|...|..:: |.|.
Yeast   397 QVLANATHSGEFLKRKLVDFVHEHKGASSKIENFIKHEILEKDLG-----IYDYTDSDLETLIHL 456

  Fly   458 DTTSAEFE--------FQATVPLSSETHGAEDVGVFA----SGPFEHLFT---GNYEQSAI 503
            |..:...:        |:|.:..::..|.|.||.::|    ...:.::..   ||:|.:.:
Yeast   457 DDNANAIQDKLNDMVSFRAQIGWTTHGHSAVDVNIYAYANKKATWSYVLNNLQGNHENTEV 517

Known Domains:


GeneSequenceDomainRegion External IDIdentity
Alp10NP_647976.1 PhoA 56..510 CDD:224699 143/517 (28%)
ALP_like 75..511 CDD:304875 137/500 (27%)
PHO8NP_010769.3 PhoA 8..530 CDD:224699 143/517 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 C21964481
eggNOG 1 0.900 E1_COG1785
Hieranoid 1 1.000
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 141 1.000 Inparanoid score I1162
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 FOG0000248
OrthoInspector 1 1.000 T634479
orthoMCL 1 0.900 OOG5_126976
Panther 1 1.100 O PTHR11596
Phylome 1 0.910 0.667 Consistency score
RoundUp 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
98.790

Return to query results.
Submit another query.